DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and SCRASP2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316661.5 Gene:SCRASP2 / 1277217 VectorBaseID:AGAP006631 Length:1343 Species:Anopheles gambiae


Alignment Length:318 Identity:92/318 - (28%)
Similarity:140/318 - (44%) Gaps:43/318 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 EVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQY--NEVRSA--CQSTPFIVGGTKASGK 111
            :|....|||.   |.|   :.....||.|      |..:  .:||:.  .::|..||||:.::..
Mosquito  1037 DVNLIKEFNS---CDI---NSRYPVAELT------CSNFECGKVRNRKYFKATKRIVGGSTSNPG 1089

  Fly   112 EFPFM-ALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRL 175
            ::||: |::|      ...::.: |.|.::..::||||:||:....:.....:.|    .:.::|
Mosquito  1090 DWPFIAAILG------GPEEVFY-CAGVLIADQWVLTASHCIGNSPTSHTMRNVN----DWTIQL 1143

  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240
            |.....|.|  ...|..:|...:.||.|:......   |||||.:|..:..|::|:..|||||..
Mosquito  1144 GITRRRSHT--YYGQKVKVKTVIPHPMYNLHIPHD---NDIALFQLATRVAFHEHLLPVCLPPPH 1203

  Fly   241 GNDVQ---QVTAAGWG------FTADGVKSSHLL-KVNLQRFSDEVCQKRLRFSIDTRTQFCAGS 295
            ..::.   ..|..|||      .|.:|......| :||:...|.|:|...|.....|....|||.
Mosquito  1204 IRELPTGINCTVVGWGKREERNSTPNGASYEPTLNEVNVPIVSRELCIDWLETFNVTEGMICAGY 1268

  Fly   296 MSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .....|.|.||||||:...:|.......|.||||:|:.|....||.||..|..:..||
Mosquito  1269 QEGGRDACQGDSGGPLLCPYPNEKDRWFVGGIVSWGVRCAHPKLPGVYANVPKFIPWI 1326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/263 (30%)
Tryp_SPc 102..353 CDD:214473 77/261 (30%)
SCRASP2XP_316661.5 Fz 753..857 CDD:279700
LDLa 889..918 CDD:238060
LDLa 921..955 CDD:294076
SRCR_2 956..>1011 CDD:295335
Tryp_SPc 1079..1326 CDD:214473 77/262 (29%)
Tryp_SPc 1080..1326 CDD:238113 77/261 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.