DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006385

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316419.4 Gene:AgaP_AGAP006385 / 1276997 VectorBaseID:AGAP006385 Length:260 Species:Anopheles gambiae


Alignment Length:274 Identity:77/274 - (28%)
Similarity:129/274 - (47%) Gaps:43/274 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 VRSACQSTP----FIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL 152
            |.|..|:.|    .:|.|..|...:||:...:..|..|..::    .||||:::.::||||.||:
Mosquito    14 VASVAQAAPRGGMRVVNGETAKLGQFPYQVRLTLHVGNGQQA----LCGGSLLNEEWVLTAGHCV 74

  Fly   153 ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVV----NYVVHPGYDTEDEEQGFK 213
            ...:|             ..|.||.:|::..|:|.     |:|    .:..|..|:    .....
Mosquito    75 MLAKS-------------VEVHLGAVDFSDNTNDG-----RLVLESTEFFKHEKYN----PLFVA 117

  Fly   214 NDIALVELDRKAEFNDHVAAVCLPP-DSGNDVQQVTAAGWGFTADGVK-SSHLLKVNLQRFSDEV 276
            ||:|||:|..|.||::.|..|.||. |.....::|..:|||...:|.: :..|....|:...::.
Mosquito   118 NDVALVKLPSKVEFSERVQPVRLPTGDEDFAGREVVVSGWGLMVNGGQVAQELQYATLKVIPNKQ 182

  Fly   277 CQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLP 340
            |||.....:..::..||.....:: .||||||||:.:...     |.::|:||:|...| .:|.|
Mosquito   183 CQKTFSPLLVRKSTLCAVGEELRS-PCNGDSGGPLVLAED-----KTLVGVVSFGHAQGCDKGHP 241

  Fly   341 SVYTKVHLYTDWIE 354
            :.:.:|..:.||::
Mosquito   242 AAFARVTAFRDWVK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/260 (28%)
Tryp_SPc 102..353 CDD:214473 72/257 (28%)
AgaP_AGAP006385XP_316419.4 Tryp_SPc 27..254 CDD:214473 72/258 (28%)
Tryp_SPc 28..257 CDD:238113 73/260 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.