DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006120

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316180.4 Gene:AgaP_AGAP006120 / 1276790 VectorBaseID:AGAP006120 Length:899 Species:Anopheles gambiae


Alignment Length:313 Identity:89/313 - (28%)
Similarity:133/313 - (42%) Gaps:79/313 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 CPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSK 128
            |.:|:          .|...|:...||.:|        |:||..:...::|:...|    .|:.|
Mosquito   639 CGLPM----------VRDKPKKNYLYNMLR--------IIGGKTSRRGQWPWQVAI----LNRFK 681

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
            ...   |||::|..:::||||||:.               .:..|||||  :|....|....:||
Mosquito   682 EAF---CGGTLVSSRWILTAAHCVR---------------KRLFVRLGE--HNLQQSDGTEIEFR 726

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP-----DSGNDVQQVTAAGWG 253
            |...:.||.||.:..:    ||:||::|.|:.|.::.:...|||.     .:|:   ..|..|||
Mosquito   727 VELSIKHPRYDKKTVD----NDVALLKLPREVERSNFIGYSCLPERYQALPTGH---TCTIIGWG 784

  Fly   254 FTADGVKSSH--------LLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGP 310
                  |..|        |.:..:....:|.|:........|:..||||....:.|||.||||||
Mosquito   785 ------KKRHNDDAGTDILHEAEVPIVPNERCRAVYHDYTITKNMFCAGHKRGRIDTCAGDSGGP 843

  Fly   311 IF------VQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            :.      :..|.     .:.||.|:|..||.|....:||||..|.|||.|::
Mosquito   844 LLCRDATKLNSPW-----TIYGITSFGDGCGKQNKFGIYTKVPNYVDWIWSVI 891

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/272 (30%)
Tryp_SPc 102..353 CDD:214473 79/269 (29%)
AgaP_AGAP006120XP_316180.4 Tryp_SPc 658..887 CDD:214473 80/278 (29%)
Tryp_SPc 659..887 CDD:238113 79/269 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.