DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006087

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_316143.4 Gene:AgaP_AGAP006087 / 1276758 VectorBaseID:AGAP006087 Length:342 Species:Anopheles gambiae


Alignment Length:333 Identity:95/333 - (28%)
Similarity:132/333 - (39%) Gaps:54/333 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 CPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQ-YNEVRSACQSTPF 101
            |||:   ..::...|...:..::::...:|..:.    :..|...::..|| |..|.  |...|.
Mosquito     2 CPVV---SRIMLRTVNILESHSELIVNVLPRGND----SSSTNETDRSVKQAYRSVE--CDVDPS 57

  Fly   102 -----IVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAE 160
                 ||||..|...:.|| ::|...:...:........||||::....||||:||..|..|   
Mosquito    58 DLGERIVGGRNALYGDAPFHVSLRSLYHERRHGFGSGLFCGGSLITASRVLTASHCFTTKPS--- 119

  Fly   161 RLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKA 225
                     ..||..|.|  |.......:|..||:.|:.|||:    ..:....||.||.|....
Mosquito   120 ---------NMVVVAGVL--NRFDRSKRMQQRRVLRYLSHPGW----HARTLAADIGLVALVSPF 169

  Fly   226 EFNDHVAAVCL---PPDSGNDVQQVTAAGWGFTADGVKSSH----LLKVNLQRFSDEVCQKRLRF 283
            :....|..:.|   ||..|   :..|..|||.|.:|.|...    |.|.::.....|.|.:.|..
Mosquito   170 QCGGGVQPIALANRPPVDG---EPCTIYGWGQTEEGRKQRFQPVCLQKASVSVLGLERCNRSLHT 231

  Fly   284 SIDTRT-QFCAGSMSSQADTCNGDSGGPIFV--QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTK 345
            .:.... ..||||.....|:|.||||||:..  ...||       ||||:|..||....|.|||.
Mosquito   232 VVTVPDGTLCAGSFDGGVDSCQGDSGGPLVCGGGGALY-------GIVSFGWGCGRANFPGVYTD 289

  Fly   346 VHLYTDWI 353
            |..|..||
Mosquito   290 VFQYRGWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 83/263 (32%)
Tryp_SPc 102..353 CDD:214473 81/261 (31%)
AgaP_AGAP006087XP_316143.4 Tryp_SPc 62..297 CDD:214473 81/262 (31%)
Tryp_SPc 63..297 CDD:238113 81/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.