DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005707

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315716.4 Gene:AgaP_AGAP005707 / 1276376 VectorBaseID:AGAP005707 Length:299 Species:Anopheles gambiae


Alignment Length:290 Identity:76/290 - (26%)
Similarity:120/290 - (41%) Gaps:78/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 NEVRSACQSTPFIVGGTKASGKEFPFM--ALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCL 152
            ::|||:     .|..|..|:..:||:.  .||       |.|..:..|.|.::.|:||||||.|:
Mosquito    55 DQVRSS-----RISDGQIATATQFPWAVGVLI-------SGSSSHSFCSGVLISPRFVLTAAVCI 107

  Fly   153 ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDF-RVVNYVVHPGYDTEDEEQGF--KN 214
            .             .|....:.||      .:|...|::| .|.|.:.||.|.:      |  ::
Mosquito   108 S-------------GSNTLTILLG------ASDMTRVEEFIGVSNILSHPNYSS------FFNRD 147

  Fly   215 DIALVELDRKAEFNDHVAAVCLP--PDSGNDVQQ--VTAAGWGFTADGVKSSHLLKVNLQRFSDE 275
            |||::.|...|...:.:..:.||  .|.||:...  .|.||||.|.             :|.::.
Mosquito   148 DIAILTLSSPAPIRNTIRPIDLPRWSDVGNNFNNWAATTAGWGNTG-------------RRENEP 199

  Fly   276 VCQKRLRFSIDT-RTQFCAG------------SMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGI 327
            :....|.|::|: .:.|..|            :.:.....||||.|||:.|.......|   :||
Mosquito   200 IPIPNLHFAVDSVNSNFVCGLSHTFIRDTHICTSTDNGGPCNGDEGGPVTVTESGRTFL---VGI 261

  Fly   328 VSY---GLVCGSQGLPSVYTKVHLYTDWIE 354
            .|:   ||....:|..:|:|::..|..||:
Mosquito   262 HSFHYSGLFGCDRGRSAVHTRITEYLGWIQ 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/278 (26%)
Tryp_SPc 102..353 CDD:214473 71/275 (26%)
AgaP_AGAP005707XP_315716.4 Tryp_SPc 61..290 CDD:214473 71/276 (26%)
Tryp_SPc 62..293 CDD:238113 73/278 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.