DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005708

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315715.4 Gene:AgaP_AGAP005708 / 1276375 VectorBaseID:AGAP005708 Length:275 Species:Anopheles gambiae


Alignment Length:305 Identity:84/305 - (27%)
Similarity:132/305 - (43%) Gaps:73/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 KQCKQYNE-----VRSACQ-------STPFIVGGTKASGKEFPFMA---LIGTHRPNKSKSDINW 133
            |.|..|..     |.::|.       .:..|..|..|...:|||||   :.||:..:        
Mosquito     3 KHCLSYGAVGLLIVLASCTLAIELRGPSSRISNGQVAGPTQFPFMAGILISGTNERS-------- 59

  Fly   134 DCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNY- 197
            .|.|:::..:||||||.|:             ..:..|.|.||..|  .|..:.::....:.:: 
Mosquito    60 FCAGALISRRFVLTAAACI-------------VGTNTFTVLLGASD--MTRIEQIIPVLNIPSHI 109

  Fly   198 VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP-----PDSGNDVQQVTAAGWGFTAD 257
            ::||||.....    ::||||::|.|.|:...:|..|.||     ..:.|| ...|.||||.|  
Mosquito   110 IIHPGYSALLN----RDDIALLQLSRDADLTPNVQVVNLPRRYHTAFTFND-WSATVAGWGNT-- 167

  Fly   258 GVKSSHLLKVNLQRF------SDEVCQKRLRFSIDTRTQFCAGSMSSQADT---CNGDSGGPIFV 313
            |.:.:..:.:...:|      |:.||.....|..|       |::.|..|.   ||||.|||::|
Mosquito   168 GNRDNEPIPLQQLQFATGSVVSNFVCGISHSFIRD-------GNICSSTDNGGPCNGDEGGPVWV 225

  Fly   314 QHPLYPCLKQVIGIVSY---GLVCGSQGLPSVYTKVHLYTDWIES 355
            ..   ...:.:||:.|:   ||....:|..||:|::..|.|||::
Mosquito   226 TE---GGDRFLIGVHSFHYDGLFGCDRGRSSVHTRLTEYLDWIQA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/275 (29%)
Tryp_SPc 102..353 CDD:214473 77/271 (28%)
AgaP_AGAP005708XP_315715.4 Tryp_SPc 32..265 CDD:214473 77/272 (28%)
Tryp_SPc 33..268 CDD:238113 79/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.