DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005706

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315714.4 Gene:AgaP_AGAP005706 / 1276374 VectorBaseID:AGAP005706 Length:295 Species:Anopheles gambiae


Alignment Length:335 Identity:99/335 - (29%)
Similarity:137/335 - (40%) Gaps:81/335 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 FYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQ------YNEVRSACQSTP 100
            |...|.||.:             |..:|...::...||...  :.||      .:|||||     
Mosquito    11 FCTVHAIGVD-------------PRTIDWTLVRTLHQTDAV--RAKQGLPPLTDDEVRSA----- 55

  Fly   101 FIVGGTKASGKEFPFMA--LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            .|..|..||..:||:.|  ||       |.|..:..|.|.::..:.|||||.|:.          
Mosquito    56 RIADGQIASPTQFPWAAGVLI-------SGSSAHSFCSGVLISRRHVLTAAVCIS---------- 103

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDF-RVVNYVVHPGYDTEDEEQGF--KNDIALVELDRKA 225
               .|....|.||..|..|      |::| .|.|.:.||.|.:      |  ::|||::.|..:|
Mosquito   104 ---GSNTLTVLLGASDMKS------VEEFIGVSNILSHPNYSS------FFNRDDIAILTLAHEA 153

  Fly   226 EFNDHVAAVCLPPDS--GNDVQQ--VTAAGWGFTADGVKSSHLLKV-NLQRFSDEVCQK---RLR 282
            ...|.:..|.||..|  |||...  .|.||||  ..|.:.:..:.: |||..:|.|...   .|.
Mosquito   154 PIRDTIQPVALPRRSQIGNDFNSWAATTAGWG--NSGRRDNEPIPIMNLQFATDAVTSNFRCGLS 216

  Fly   283 FSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSY---GLVCGSQGLPSVYT 344
            .:....|..|  :.:.....||||.|||:.|.......|   |||.|:   ||....:|.|||:|
Mosquito   217 HTFIRGTHIC--TATDNGGPCNGDEGGPVTVTESGRTFL---IGIHSFHFSGLFGCDRGRPSVHT 276

  Fly   345 KVHLYTDWIE 354
            ::..|.|||:
Mosquito   277 RITEYLDWIQ 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/269 (31%)
Tryp_SPc 102..353 CDD:214473 82/266 (31%)
AgaP_AGAP005706XP_315714.4 Tryp_SPc 56..285 CDD:214473 82/267 (31%)
Tryp_SPc 57..288 CDD:238113 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.