DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005691

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315702.4 Gene:AgaP_AGAP005691 / 1276364 VectorBaseID:AGAP005691 Length:301 Species:Anopheles gambiae


Alignment Length:309 Identity:84/309 - (27%)
Similarity:137/309 - (44%) Gaps:54/309 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAEQ-TRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPF-MALIGTHRPNKSK 128
            |.:|...::|.|: ...:.:...:|..:|: ...|..|..|.:|:..:||. :||:..:..:...
Mosquito    20 IEIDWSKVRPIEEFDHYWARLPAEYQFLRN-MNRTNRITNGQEATPGQFPHQIALLSEYATSTGL 83

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
                  ||||::....:||||||:.:        .|:..:...|..:|.  :|....::..|..|
Mosquito    84 ------CGGSILTRNTILTAAHCVVS--------GPSTLASGGVAIMGA--HNRNVQESTQQRIR 132

  Fly   194 VV--NYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV-----TAAG 251
            ..  ...|||.|:.    ...:||||.|.|:....|...:..:.||..|  |.:|.     |.:|
Mosquito   133 FATSGIRVHPQYNL----ASIRNDIATVRLNSPMTFTTRIQPIRLPGRS--DTRQFGGFTGTVSG 191

  Fly   252 WGFTADGVKSSHLLKVNLQRF------SDEVCQKRLRFSIDTRTQFC---AGSMSSQADTCNGDS 307
            :|.|:|...::..    :.||      ::..|..|...::......|   ||..|:    |||||
Mosquito   192 FGRTSDASTATSA----VVRFTTNPVMTNADCVARWGTTMVQNQNVCLSGAGGRSA----CNGDS 248

  Fly   308 GGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWIES 355
            ||.:.||..  ..|:  ||:||:..|.| :.|:||||.:|..:..|||:
Mosquito   249 GGALTVQSG--GTLQ--IGVVSFVSVNGCAVGMPSVYARVSFFLPWIEA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 77/272 (28%)
Tryp_SPc 102..353 CDD:214473 74/268 (28%)
AgaP_AGAP005691XP_315702.4 Tryp_SPc 55..291 CDD:214473 74/269 (28%)
Tryp_SPc 56..294 CDD:238113 77/272 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.