DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005670

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315687.1 Gene:AgaP_AGAP005670 / 1276350 VectorBaseID:AGAP005670 Length:300 Species:Anopheles gambiae


Alignment Length:308 Identity:85/308 - (27%)
Similarity:132/308 - (42%) Gaps:52/308 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMA------LIGTHRP 124
            |.:|...::|.|:...:.::.....::......|..||.|.:|:..:||:..      |.||.. 
Mosquito    19 IEIDWSQVRPIEEFDHYWERLPAEMQIYRKMLPTHRIVNGQEATPGQFPYQIALLSEFLTGTGL- 82

  Fly   125 NKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV 189
                      |||||:...::||||||:.:..:...|      ....::.....:.|..:...: 
Mosquito    83 ----------CGGSVLTNNYILTAAHCVVSGATTLAR------GGTAIMGAHNRNVNEPSQQRI- 130

  Fly   190 QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV-----TA 249
             .|.....:.||.|.|.:    .:||||:|.||....||..|....||..|  |.:|.     |.
Mosquito   131 -RFSTGGIIRHPQYTTTN----IRNDIAVVRLDAPIVFNTRVQPARLPARS--DTRQFGGFTGTV 188

  Fly   250 AGWGFTADGVKSSHLLKVNLQRFSDEV------CQKRLRFSIDTRTQFCAGSMSSQADTCNGDSG 308
            :|:|..:||..::..    :.||:...      |..|...::......|......:: .||||||
Mosquito   189 SGFGRVSDGSTATSA----VVRFTSNPVMTNADCIARWNTALIQPQNVCLSGEGGRS-ACNGDSG 248

  Fly   309 GPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWIES 355
            ||:.||..  ..|:  |||||:|...| |.|:||||.:|..:..|||:
Mosquito   249 GPLAVQDG--GSLQ--IGIVSFGSAGGCSIGMPSVYARVSFFLSWIEA 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/272 (29%)
Tryp_SPc 102..353 CDD:214473 77/268 (29%)
AgaP_AGAP005670XP_315687.1 Tryp_SPc 54..290 CDD:214473 77/269 (29%)
Tryp_SPc 55..293 CDD:238113 80/272 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.