DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005669

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315686.1 Gene:AgaP_AGAP005669 / 1276349 VectorBaseID:AGAP005669 Length:301 Species:Anopheles gambiae


Alignment Length:322 Identity:93/322 - (28%)
Similarity:135/322 - (41%) Gaps:84/322 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 IPLDHQNLKPAEQTRPFEKQCKQ----YNEVRSACQSTPFIVGGTKASGKEFPF-MALIGTHRPN 125
            |.:|...::|.|....:.::..|    |..||.:.:    :..|.:|:..:||: :||:......
Mosquito    20 IEIDWSRVRPIEDFDHYWERLPQELQIYRHVRPSHR----VTNGQEATPGQFPYQIALVSEFVIT 80

  Fly   126 KSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGEL---------DYN 181
            ...      |||||:...|:||||||:                   |...|.|         .:|
Mosquito    81 SGL------CGGSVLTNNFILTAAHCV-------------------VGTAGILASGGTAIIGAHN 120

  Fly   182 STTDDALVQDFRV--VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV 244
            ..|.:|..|..|.  ...:.||.|.:.:    .:||||||.||....|||.|..|.||..|  |.
Mosquito   121 RNTAEASQQRIRFSGPGVIPHPFYASSN----LRNDIALVRLDAPIVFNDRVQPVRLPARS--DT 179

  Fly   245 QQV-----TAAGWGFTADGVKSSHLLKVNLQRFSDEV------------CQKRLRFSIDTRTQFC 292
            :|.     |.:|:|.|:|...::          ||.|            |..:...::....|.|
Mosquito   180 RQFGGFLGTVSGFGRTSDASTAT----------SDVVMFTTNPVMTNADCIAQWNSALIEPQQVC 234

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCG-SQGLPSVYTKVHLYTDWI 353
            ......:: .||||||||:.||..  ..|:  ||:||:|...| |.|:||||.:|..:.|||
Mosquito   235 LSGEGGRS-ACNGDSGGPLAVQDG--GSLQ--IGVVSFGSAGGCSIGMPSVYARVSFFLDWI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/282 (30%)
Tryp_SPc 102..353 CDD:214473 83/280 (30%)
AgaP_AGAP005669XP_315686.1 Tryp_SPc 55..291 CDD:214473 83/285 (29%)
Tryp_SPc 56..291 CDD:238113 83/280 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.