DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005594

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315604.2 Gene:AgaP_AGAP005594 / 1276280 VectorBaseID:AGAP005594 Length:294 Species:Anopheles gambiae


Alignment Length:292 Identity:66/292 - (22%)
Similarity:111/292 - (38%) Gaps:49/292 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 QTRPFEKQCKQYNEVRSACQSTPFIVGGT-----KASGKEFPFMALIGTHRPNKSKSDINWDCGG 137
            :..|...:..:..:..||....|:....|     .|...:||:.|.|..:..|     ..:...|
Mosquito    28 KVNPMSDETPEGFKTMSAGTVVPYTYSATYWYGYNAYAGQFPYHAEINFYTNN-----YLYKRAG 87

  Fly   138 SVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNY----- 197
            :::...:|:|.|       |.......:.|.....:.||.: :||||     |..:.:||     
Mosquito    88 ALITLNYVITPA-------SSFHHYFIHGDMLYGYITLGSV-FNSTT-----QWEQTINYTESSI 139

  Fly   198 VVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSS 262
            |:||.:...:|:.   .:||::.|||.|....:|..:.||..|  |.:...|.. |.:....|..
Mosquito   140 VMHPFFHYTNEDY---YNIAIIRLDRPAIQTRYVKPIRLPKLS--DTRTYLAME-GTSCGTTKEE 198

  Fly   263 HLLKVNLQRFSDEVCQKRLRFSIDTRTQFC-----AGSMSSQADTCNGDSGGPIFVQHPLYPCLK 322
            .|..:.....|..:|:::|.........:|     .||.      ||...|..:.|:....|.| 
Mosquito   199 GLSYLRNPLLSLSICRQQLTSYTFHDQHYCTDVYRGGSF------CNRQCGSSLTVEDENGPVL- 256

  Fly   323 QVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
              ||:|.....| |...|..|.::..:.:||:
Mosquito   257 --IGVVDLLFQC-SYSYPVRYVRLSAFREWIQ 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 62/268 (23%)
Tryp_SPc 102..353 CDD:214473 60/265 (23%)
AgaP_AGAP005594XP_315604.2 Tryp_SPc 60..285 CDD:304450 60/258 (23%)
Tryp_SPc 60..284 CDD:214473 59/257 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.