DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005591

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_315601.4 Gene:AgaP_AGAP005591 / 1276277 VectorBaseID:AGAP005591 Length:273 Species:Anopheles gambiae


Alignment Length:298 Identity:64/298 - (21%)
Similarity:119/298 - (39%) Gaps:72/298 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDIN-WDCG 136
            |.|.|  ||..|           ...:|....|..|...:||:.|.:..    |:||... :.|.
Mosquito    23 LDPVE--RPSAK-----------IAPSPLATDGYLAYPGQFPYHAALRF----KTKSSTKVYTCA 70

  Fly   137 GSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVR-LGELDYNSTTDDALVQDFRVVNYVVH 200
            ||::.|.::||.|.|:            |.:|.::... ||.| :|..|:.....:..:....:|
Mosquito    71 GSLITPVYILTTAACV------------NHNSVEYAFAILGSL-FNGNTEWEQHINITMNGIRIH 122

  Fly   201 P-----GYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN---DVQQVTAAGWGFTAD 257
            |     |:          ||||.:.:|..|..|::|..:.||..|..   ::.:.||.. ....|
Mosquito   123 PPSSMYGH----------NDIATIHMDHPATLNEYVQPIRLPRLSDTRTYEMMEGTATS-ALNGD 176

  Fly   258 GVKSSHLLKVNLQRFSDEVCQKRLR--FSIDTR----TQFCAGSMSSQADTCNGDSGGPIFVQHP 316
            |::     .:..|..|:..|.:.::  ::|.::    ..:..||:      |...:|..:.|:..
Mosquito   177 GLR-----YLRNQVMSNADCHEAIQPLYNISSQHICTDTYIGGSL------CGRTTGSALTVEDE 230

  Fly   317 LYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            ..   :.::|:.:..::|... .|..:.:|..:.:|||
Mosquito   231 NG---RMLVGVGNLIVLCDLH-YPIRHIRVSYFREWIE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 57/269 (21%)
Tryp_SPc 102..353 CDD:214473 54/266 (20%)
AgaP_AGAP005591XP_315601.4 Tryp_SPc 42..264 CDD:238113 55/264 (21%)
Tryp_SPc 42..263 CDD:214473 54/263 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.