DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004900

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314989.4 Gene:AgaP_AGAP004900 / 1275705 VectorBaseID:AGAP004900 Length:265 Species:Anopheles gambiae


Alignment Length:263 Identity:79/263 - (30%)
Similarity:129/263 - (49%) Gaps:48/263 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI----GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            ||.||.|:.:.:||:..:    |.|           .||||:::.:::||||||::         
Mosquito    31 IVNGTDAAIENYPFVVSLRGASGGH-----------SCGGSILNDRWILTAAHCVD--------- 75

  Fly   163 DPNFDSPKF-VVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAE 226
               :.:|.: .:::|..|.:.|.|:::   :.:.:.|:||||:..|   .:.:||||::|.:...
Mosquito    76 ---YTTPLYQTIQVGRADISRTEDESV---YAIEDVVIHPGYNPAD---SYIDDIALLKLRKPLV 131

  Fly   227 FNDHVAAVCLPPDSGN-DVQQ---VTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRLRFSID 286
            |.|.|..|.||..... |||:   ||..|||..| ||...:.|.:::.....::.| .|:..:..
Mosquito   132 FTDQVQPVRLPKRFFEIDVQESNLVTLVGWGRNASDGPVQTTLQEIDYYAVPNDEC-NRIHSNHI 195

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTKVHLYT 350
            ..||.||.........|:||||||:..:       :..:||||:.: .|.....|.|.|||..|.
Mosquito   196 YPTQICAAEPGGGKGQCSGDSGGPLIYK-------EFQVGIVSWSIKPCAIAPYPGVLTKVSYYV 253

  Fly   351 DWI 353
            |:|
Mosquito   254 DFI 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 79/263 (30%)
Tryp_SPc 102..353 CDD:214473 78/261 (30%)
AgaP_AGAP004900XP_314989.4 Tryp_SPc 30..256 CDD:214473 78/261 (30%)
Tryp_SPc 31..259 CDD:238113 79/263 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.