DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP008808

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_557970.3 Gene:AgaP_AGAP008808 / 1275666 VectorBaseID:AGAP008808 Length:574 Species:Anopheles gambiae


Alignment Length:283 Identity:81/283 - (28%)
Similarity:124/283 - (43%) Gaps:45/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 RSACQSTPFIVGGTKASGKEFPFMALI--GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETD 155
            |...||...|..|..|....:|:.|.|  |..|..:      :.||||::....:|||:||:.|.
Mosquito    35 RRKVQSVFLIHNGVDAKAGHWPWHAAIFHGNGRQEE------YQCGGSILDQNTILTASHCVYTH 93

  Fly   156 ES--KAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIAL 218
            :|  .|.|:.         |.:|::....|::  ..|...|.:.::||.:::    ..|.|||||
Mosquito    94 KSVISAARVS---------VHVGQIHLKETSE--YTQIHGVQDIILHPEFNS----NSFNNDIAL 143

  Fly   219 VELDRKAEFNDHVAAVCL-PPDSGNDV---QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK 279
            ::|........:|..||| ..||..::   :..|..|:|.....|.|..|.:..:.......|.|
Mosquito   144 LKLSTNITMTKYVQPVCLWTMDSNQEMIVGKNGTIVGFGLNEHDVVSDQLKQALVGVVDALTCIK 208

  Fly   280 --RLRFS-IDTRTQFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGIVSYGLVCGSQGL 339
              |..|. :.|...|| |...:....|||||||.:|  |....:     |.|:||:..:.|:.||
Mosquito   209 SDRAAFGPVLTSEMFC-GKGRTGVGACNGDSGGGMFFEVGGKWF-----VRGLVSFTPLRGNTGL 267

  Fly   340 --P---SVYTKVHLYTDWIESIV 357
              |   :.||.|..|.:||:..:
Mosquito   268 CDPLKYTAYTDVAKYLEWIKQYI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 78/271 (29%)
Tryp_SPc 102..353 CDD:214473 76/268 (28%)
AgaP_AGAP008808XP_557970.3 Tryp_SPc 44..288 CDD:238113 78/270 (29%)
Tryp_SPc 46..286 CDD:214473 75/266 (28%)
Tryp_SPc 324..566 CDD:304450
Tryp_SPc 330..566 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.