DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP008649

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314746.4 Gene:AgaP_AGAP008649 / 1275498 VectorBaseID:AGAP008649 Length:312 Species:Anopheles gambiae


Alignment Length:306 Identity:82/306 - (26%)
Similarity:136/306 - (44%) Gaps:66/306 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 KQYNEVRSACQSTPF-----------------------IVGGTKASGKEFPFMALIGTHRPNKSK 128
            |::..::||...||.                       ::||..:...::|:||.:...:     
Mosquito    23 KRFPCIKSAFNPTPILSSISRSVVCGKVPNPPLPNSLRVIGGNTSDIDQYPWMAALYYRQ----- 82

  Fly   129 SDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
               .:.||||:::.:::||||||:           ...|:..|.|.|...:..:...:|:.:  |
Mosquito    83 ---QFTCGGSLINDRYILTAAHCV-----------ARMDAAGFEVYLRRPNIVTLNPEAVHR--R 131

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN-DVQQVTAAGWGFTAD 257
            |...|::     ..:|....||:||:.|.......|.:..:|||.|..| |.::....|||.|..
Mosquito   132 VARIVMN-----RYQELRNNNDVALLLLKEPVGVADGLVPICLPVDGSNFDGKEAIVTGWGTTES 191

  Fly   258 GVKSSHLLKVNLQRFSDEVCQKR--LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV------Q 314
            |..|.||.::.:...:::.|:|.  .||.| |....|||.:....|:|.||||||:.:      |
Mosquito   192 GELSEHLQQLTVPILTNQQCRKSGYFRFQI-TAKMLCAGYLEGGRDSCQGDSGGPLQLAKGETDQ 255

  Fly   315 HPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVWGN 360
                   :|::|:||:|..|..:..|.||.:|..:..||.|...||
Mosquito   256 -------QQIVGVVSWGNECAQRNYPGVYARVTRFVSWIRSHSAGN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/262 (28%)
Tryp_SPc 102..353 CDD:214473 72/259 (28%)
AgaP_AGAP008649XP_314746.4 Tryp_SPc 60..287 CDD:214473 72/260 (28%)
Tryp_SPc 61..290 CDD:238113 74/262 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.