DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPE5

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314516.3 Gene:CLIPE5 / 1275278 VectorBaseID:AGAP010547 Length:373 Species:Anopheles gambiae


Alignment Length:349 Identity:83/349 - (23%)
Similarity:141/349 - (40%) Gaps:66/349 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YCDNGTGECKELTPSDCPVIFYNQHLI-GAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQ 85
            |.....|.|  :....||.|  .|.:. |..:..|.. ..:||||......|  |:|..|.|.:.
Mosquito    77 YSGGVQGVC--VAHDRCPSI--RQRMSNGDSIIICSG-GSVVCCPRTDVTSN--PSEIEREFNEC 134

  Fly    86 CKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAH 150
            .::|.::|...|..   ..|.:......|..|.:|.    :..|:|.:.|...::....|:|:|.
Mosquito   135 GQRYVQLRKQRQQQ---WEGFQPLRLRLPHFAEVGW----EEGSEIRFQCIAYLISTSAVVTSAS 192

  Fly   151 CLETDESKAERLDPNFDSPKFVVRLGELDYN-STTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN 214
            ||.:.|     .:|.      |||||.:... .||:.|::.   :....:||    |..:..|:|
Mosquito   193 CLVSKE-----FEPT------VVRLGNIRSGPQTTNIAIIP---ISTVEIHP----EFNQSTFEN 239

  Fly   215 DIALVELDRKAEFNDHVAAVCL-------PPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRF 272
            :|||::|....:...::...||       |.:|.     :...|.||  |.:...::...|: ||
Mosquito   240 NIALLKLTLPVQPTVYMFPGCLWQNKTHSPVESA-----IFRGGNGF--DPIHPMYVRDCNV-RF 296

  Fly   273 SDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGP-IFVQHP---LYPCLKQVIGIVSYGLV 333
            :        |...|.|.......:....:.|. .:|.| ||.|:.   |:  .:.::.|.|:|. 
Mosquito   297 A--------RTFSDPRITCMVPGVYGTGEHCY-PTGSPIIFRQNEDTNLF--TEYLVNIYSHGR- 349

  Fly   334 CGSQGLPSVYTKVHLYTDWIESIV 357
            |.|..|..|: ::.:|.||.:.::
Mosquito   350 CNSTSLRIVH-RIAMYIDWFKEVL 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 62/265 (23%)
Tryp_SPc 102..353 CDD:214473 61/262 (23%)
CLIPE5XP_314516.3 Tryp_SPc 174..>261 CDD:304450 25/104 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.