DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP010546

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314515.4 Gene:AgaP_AGAP010546 / 1275277 VectorBaseID:AGAP010546 Length:295 Species:Anopheles gambiae


Alignment Length:257 Identity:89/257 - (34%)
Similarity:125/257 - (48%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 GTKASGKEFPFMALIG-THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDS 168
            |..|..:||..:|.|| |....|    :||.||||::...|:||||||...||          |.
Mosquito    67 GNPALLREFAHIAAIGWTGADGK----VNWGCGGSLIWENFILTAAHCAANDE----------DV 117

  Fly   169 PKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFK---NDIALVELDRKAEFNDH 230
            |..|.|:|:|:..|..||...|..|:|..:.|       ::..|.   .|:||::|::....::.
Mosquito   118 PPDVARMGDLNIYSDDDDEFPQQLRIVKVIRH-------QQHRFSAKYYDVALMQLEKNITVHET 175

  Fly   231 VAAVCLPPDSGNDVQQVTAAGWGFTADGV-KSSHLLKVNLQRFSDEVCQK-------RLRFSIDT 287
            ||..||..|......::.|||||.|..|. |::.||||:|...::..|.|       .||..:..
Mosquito   176 VAPACLWLDDEVRFPKLYAAGWGRTGFGEDKTNILLKVDLTPMNNTQCSKFYTSSERGLRNGLHA 240

  Fly   288 RTQFCAGSMSSQADTCNGDSGGPIFVQ--H--PLYPCLKQVIGIVSYGLVCGSQGLPSVYTK 345
            . ..|||  ..:.|||.||||||:.|:  |  .:.|.|   :|:.|:|..|| |..|.||.:
Mosquito   241 H-HLCAG--DEKMDTCPGDSGGPLHVKLLHNAKMTPFL---VGVTSFGKPCG-QANPGVYAR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 89/257 (35%)
Tryp_SPc 102..353 CDD:214473 89/257 (35%)
AgaP_AGAP010546XP_314515.4 Tryp_SPc 67..295 CDD:214473 89/255 (35%)
Tryp_SPc 67..295 CDD:238113 89/255 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.