DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPE4

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314499.3 Gene:CLIPE4 / 1275261 VectorBaseID:AGAP010530 Length:302 Species:Anopheles gambiae


Alignment Length:334 Identity:73/334 - (21%)
Similarity:128/334 - (38%) Gaps:85/334 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 GAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCK-QYNEVRSACQSTPFIVGGTKASG-- 110
            |..|..|.: ..:||||.. |.......:..|.....|: :|:.:|.           .:.||  
Mosquito    20 GERVTLCTD-GTVVCCPWG-DISRNSGGDLIRTELDSCENRYHSLRR-----------QRYSGFS 71

  Fly   111 ------KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSP 169
                  ...|.:|.:|..:.|   ..|.::|.|.::....::|:|.||||           :...
Mosquito    72 QNESLYSNLPHVAEVGWPQNN---GGIAFECFGYLITSSIIVTSARCLET-----------YSYK 122

  Fly   170 KFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAV 234
            ..|.|:|.:. .:.:.:.::|..|.|.  ||..||:    |...|:|.|:.|....|.|::....
Mosquito   123 PVVARIGSVQ-AADSSNYIIQTIRRVR--VHDDYDS----QTGANNIGLLILAAPIEINEYHFPG 180

  Fly   235 CLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQ 299
            ||..::.:...:..|     .:|...::..|||:....|:  ||:||...: ...|.|.  :.:|
Mosquito   181 CLYRNNTHLPTRQFA-----ISDDRDATFFLKVSPIYQSE--CQQRLTVPL-VSGQMCL--LKAQ 235

  Fly   300 ADTCNGDSGGPIFVQHPLYPCLK--------------------QVIGIVSYGLVCGSQGLPSVYT 344
                      |..|.:|...||:                    .::|:.|:| .|..:.: .:.|
Mosquito   236 ----------PEGVYNPRNKCLRTGDVIVWEPRTEEEDVMDVVYLVGLFSHG-GCNVENV-QIGT 288

  Fly   345 KVHLYTDWI 353
            ::..|.|||
Mosquito   289 RISSYYDWI 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 61/280 (22%)
Tryp_SPc 102..353 CDD:214473 59/278 (21%)
CLIPE4XP_314499.3 Tryp_SPc 82..297 CDD:214473 56/257 (22%)
Tryp_SPc 82..297 CDD:304450 56/257 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.