DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP010528

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314498.2 Gene:AgaP_AGAP010528 / 1275260 VectorBaseID:AGAP010528 Length:223 Species:Anopheles gambiae


Alignment Length:141 Identity:41/141 - (29%)
Similarity:63/141 - (44%) Gaps:25/141 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 KEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRL 175
            :::..:|.||..|   :...|:|.|.|:::....|:|:|.| .|||...        .|. ||||
Mosquito    73 RDYSHIATIGRRR---NGGTIDWTCMGALIWDSVVITSAQC-TTDEGNG--------IPS-VVRL 124

  Fly   176 GELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDS 240
            |...|        ||...:...:.||.:...:.:    |||||::||||...|:.....||....
Mosquito   125 GGTKY--------VQVINIKEVIRHPDFLPSNGQ----NDIALLQLDRKIIINETAVPTCLWLFD 177

  Fly   241 GNDVQQVTAAG 251
            |...|::.:.|
Mosquito   178 GVPFQKLDSIG 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 41/141 (29%)
Tryp_SPc 102..353 CDD:214473 41/141 (29%)
AgaP_AGAP010528XP_314498.2 Tryp_SPc 71..>173 CDD:304450 36/124 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.