DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004858

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314333.4 Gene:AgaP_AGAP004858 / 1275108 VectorBaseID:AGAP004858 Length:435 Species:Anopheles gambiae


Alignment Length:255 Identity:88/255 - (34%)
Similarity:130/255 - (50%) Gaps:40/255 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 MALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDY 180
            ||.||..:.|.|   |::|||||::.|:.|||||||...|:..|.:          |||||.:|.
Mosquito     1 MAAIGWRQTNGS---ISFDCGGSLITPRHVLTAAHCALNDDGVAPQ----------VVRLGVIDI 52

  Fly   181 NSTTDD---ALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGN 242
            .:...|   ...|::.:.::..||    |.|.:...:||.||.|||.....|.|...||...:..
Mosquito    53 TAGLYDPQNQFAQEYGISSFRRHP----EHEFRAEYHDIGLVTLDRPVTLTDAVVPACLWTGAQV 113

  Fly   243 DVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVC-------QKRLRFSIDTRTQFCAGSMSSQ 299
            .::::.|.|:|.|: .|.::..||||.|....:..|       ::|.:..||  .|.||.  ..:
Mosquito   114 PLRRLEAVGFGQTSFGGERTPILLKVQLSPVDNSACGRFYPPSRRRRQGLID--QQMCAS--DER 174

  Fly   300 ADTCNGDSGGP----IFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            .|||:||||||    :...:.|.|.   |:||.|:|..||: ..|:|||:|..|.||:::
Mosquito   175 MDTCHGDSGGPLQLKLMANNRLIPF---VVGITSFGRFCGT-ATPAVYTRVSSYVDWLQT 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 88/255 (35%)
Tryp_SPc 102..353 CDD:214473 87/251 (35%)
AgaP_AGAP004858XP_314333.4 Tryp_SPc 1..229 CDD:238113 88/252 (35%)
Tryp_SPc 1..227 CDD:214473 86/250 (34%)
Tryp_SPc 295..>384 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.