DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004859

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_314332.2 Gene:AgaP_AGAP004859 / 1275102 VectorBaseID:AGAP004859 Length:264 Species:Anopheles gambiae


Alignment Length:264 Identity:66/264 - (25%)
Similarity:117/264 - (44%) Gaps:43/264 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFD 167
            |.|..:...:...:.|:|:.|.:.::   .:.||||.:....||..|||: |.:::     |..|
Mosquito    20 VQGIFSQNPQTSHIVLLGSTRSDGTR---EFRCGGSYIGQNIVLAGAHCV-TGKNQ-----PALD 75

  Fly   168 SPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF---ND 229
            :.:|         .|.||:  |..||:||:.:|..|..:.|    .:::|:..||.:.:.   ..
Mosquito    76 TVRF---------GSGTDN--VMHFRIVNHTLHYRYKPQFE----YHNMAVYYLDARPDLVNAGR 125

  Fly   230 HVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQK------RLRFSIDTR 288
            ...|..|.|.....:.|:.    |.:::| :...|...:|...:.|.|.:      :|||.: ..
Mosquito   126 FKPACILKPHMKQGIVQMV----GDSSNG-RGLALQSTSLDVVASEKCHEYYNPIPKLRFGV-LL 184

  Fly   289 TQFCAGSMSSQADTCNGDSGGPI-FVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDW 352
            ..|||  |:|....|:.....|: .|.:.....:..:||..|.|..||.:. |:|:|:...|.:|
Mosquito   185 CCFCA--MNSDTTECSNMHSSPLQLVINRNGKSVPFLIGHKSIGKACGVKS-PAVFTRYGSYYEW 246

  Fly   353 IESI 356
            :|:|
Mosquito   247 LETI 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 65/262 (25%)
Tryp_SPc 102..353 CDD:214473 63/259 (24%)
AgaP_AGAP004859XP_314332.2 Trypsin 41..247 CDD:278516 58/238 (24%)
Tryp_SPc 43..250 CDD:304450 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.