DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005072

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313947.4 Gene:AgaP_AGAP005072 / 1274755 VectorBaseID:AGAP005072 Length:857 Species:Anopheles gambiae


Alignment Length:244 Identity:69/244 - (28%)
Similarity:111/244 - (45%) Gaps:45/244 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   132 NWDCGGSVVHPKFVLTAAHCL---ETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFR 193
            ::.||.::::..|||||:||:   :|....:|:|        ..|||| :...|....:.||.:.
Mosquito    82 DYQCGCTLINELFVLTASHCVYNSDTGYKISEKL--------VRVRLG-MHRLSANGSSAVQTYT 137

  Fly   194 VVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV-----TAAGWG 253
            |...:.|..:.....    |:|:||:.|:...:|.:::..|||.......|:.:     |..|||
Mosquito   138 VQKIIPHSKFVPNTH----KHDVALLRLNGTVKFTNYIQPVCLDLTESIWVEYLADVYGTVVGWG 198

  Fly   254 FTADGVKSSHLLKVNLQ--RFSDEVCQK-------RLRFSIDTRTQFCAGSMSSQADTCNGDSGG 309
            .|.....|..|||..|.  |::|  |.:       ||.:|    ..:|||.::. ...|||||||
Mosquito   199 LTEKNRISDQLLKAELPIVRYTD--CVESNPDLYGRLIYS----GMYCAGILNG-TSPCNGDSGG 256

  Fly   310 PIFVQHPLYPCLKQVIGIVSY-GLVCGSQGLPS----VYTKVHLYTDWI 353
            .:::.......|:   |:||: |:..|:....|    |:..|..|..||
Mosquito   257 GMYIFRENRWFLR---GVVSFSGIREGTNYCDSFSYVVFMNVPYYAKWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 69/244 (28%)
Tryp_SPc 102..353 CDD:214473 67/242 (28%)
AgaP_AGAP005072XP_313947.4 Tryp_SPc 59..302 CDD:214473 67/242 (28%)
Tryp_SPc 60..302 CDD:238113 67/242 (28%)
IG_like 373..447 CDD:214653
IGc2 377..436 CDD:197706
LamG 451..600 CDD:238058
LamG 673..826 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.