DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP005065

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313940.4 Gene:AgaP_AGAP005065 / 1274748 VectorBaseID:AGAP005065 Length:246 Species:Anopheles gambiae


Alignment Length:261 Identity:74/261 - (28%)
Similarity:108/261 - (41%) Gaps:49/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            ||||..|...:.|:...:   |:.|           ||||::..:.|||||||:..|:.    |.
Mosquito    29 IVGGQLAEDTQMPYQIALFYQGSFR-----------CGGSIIGDRHVLTAAHCVMDDDV----LL 78

  Fly   164 PNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
            |.|   ||.|..|....|     |..:.|:|.....|.||.      .|::|||::|:.....|:
Mosquito    79 PAF---KFGVHAGSAHLN-----AGGKLFKVRAVYPHEGYG------NFQHDIAVMEMKEPFAFD 129

  Fly   229 DHVAAVCLPPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFC 292
            .::..:.|..:......:|..:|:| ..::|..|..||..::....||.|.     || :....|
Mosquito   130 KYIQPIELMDEEVPLGGEVVISGYGRVGSNGPVSPALLYTSMFVVEDENCN-----SI-SEGLMC 188

  Fly   293 AGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGL-VCGSQGLPSVYTKVHLYTDWIESI 356
            .....|.. .||||||||......|       .|:.::.: .||. .....|.||..|.|||...
Mosquito   189 IDKEGSYG-ACNGDSGGPAVYDGKL-------AGVANFIIDQCGG-NFADGYAKVSFYLDWIRQF 244

  Fly   357 V 357
            :
Mosquito   245 L 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 74/258 (29%)
Tryp_SPc 102..353 CDD:214473 72/255 (28%)
AgaP_AGAP005065XP_313940.4 Tryp_SPc 28..241 CDD:214473 72/255 (28%)
Tryp_SPc 29..243 CDD:238113 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.