DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004570

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313874.5 Gene:AgaP_AGAP004570 / 1274709 VectorBaseID:AGAP004570 Length:259 Species:Anopheles gambiae


Alignment Length:283 Identity:86/283 - (30%)
Similarity:136/283 - (48%) Gaps:51/283 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 FEKQCKQYN-EVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFV 145
            |..:|...| |:|        ||||......::|::|        :...|..:.||.|::...:|
Mosquito     9 FFSECGAANQEIR--------IVGGRPTGVNQYPWLA--------RLVYDGQFHCGASLLTKDYV 57

  Fly   146 LTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVV-HPGYDTEDEE 209
            ||||||:       .||..|    |..|.||:.|....::...:  .|.|..:: |..:|    :
Mosquito    58 LTAAHCV-------RRLKRN----KIRVILGDYDQFVASETPAI--MRAVTAIIRHRSFD----Q 105

  Fly   210 QGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV-TAAGWGFTADGVKSSHLLK-VNLQRF 272
            ..:.:||||::|.:..||...:..||||.:......|: |..|||.|::|.....|:: |::...
Mosquito   106 NSYNHDIALLKLRKPVEFTKTIRPVCLPKERSEPAGQLGTVVGWGRTSEGGTLPALVQHVDVPIL 170

  Fly   273 SDEVCQK-RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV----QHPLYPCLKQVIGIVSYGL 332
            :.:.|:. :.|.|..|....|||  ..:.|:|.||||||:.|    :|       :::||||:|:
Mosquito   171 TLDQCRSMKYRASRITSNMLCAG--KGKQDSCQGDSGGPLLVRNGDKH-------EIVGIVSWGV 226

  Fly   333 VCGSQGLPSVYTKVHLYTDWIES 355
            .||..|.|.|||:|..|..|:.:
Mosquito   227 GCGRAGYPGVYTRVARYLPWLRA 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/262 (31%)
Tryp_SPc 102..353 CDD:214473 80/258 (31%)
AgaP_AGAP004570XP_313874.5 Tryp_SPc 21..246 CDD:214473 81/266 (30%)
Tryp_SPc 22..250 CDD:238113 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.