DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP004566

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313869.5 Gene:AgaP_AGAP004566 / 1274708 VectorBaseID:AGAP004566 Length:327 Species:Anopheles gambiae


Alignment Length:337 Identity:99/337 - (29%)
Similarity:153/337 - (45%) Gaps:73/337 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 TPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQS 98
            |..:.|.|.:...|||:           ...|.|   :||.|.:.. |..| |.:.|.:..    
Mosquito    38 TEKNNPFIEWLAGLIGS-----------TSTPAP---ENLTPPDSC-PMCK-CGRTNRLTR---- 82

  Fly    99 TPFIVGGTKASGKEFPFMALI---GTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAE 160
               ||||.:....::|:||::   ||           :.||||::..:.|||||||:.       
Mosquito    83 ---IVGGQETQVNQYPWMAMLQYSGT-----------FYCGGSLISDRHVLTAAHCVH------- 126

  Fly   161 RLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKA 225
                .|:..|..|.|.|.|..||: :::....:|:..:.|.||::.:    :.:|||::.|....
Mosquito   127 ----GFNRNKISVVLMEHDRVSTS-ESMTMVSKVLRVIEHNGYNSNN----YNSDIAILRLATVM 182

  Fly   226 EFNDHVAAVCLP----PDSGNDVQQVTAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQK------ 279
            ...|.:..||||    |.:|.|   ....|||.|:: |..|::|.:|.:...|:..|:|      
Mosquito   183 TIEDKLRPVCLPTPKKPFTGYD---GIVTGWGATSENGAISTNLQEVTVPIMSNADCRKTGYGAS 244

  Fly   280 RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV-QHPLYPCLKQVIGIVSYGLVCGSQGLPSVY 343
            |:     |....|||....:.|:|.||||||:.| :......:.|:.||||:|..|.....|.||
Mosquito   245 RI-----TDNMLCAGYDEGKKDSCQGDSGGPLHVIKQNSTDNVHQIAGIVSWGEGCAKPNYPGVY 304

  Fly   344 TKVHLYTDWIES 355
            |:|:.:..||.|
Mosquito   305 TRVNRFGTWIRS 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 84/269 (31%)
Tryp_SPc 102..353 CDD:214473 81/265 (31%)
AgaP_AGAP004566XP_313869.5 Tryp_SPc 82..314 CDD:214473 81/273 (30%)
Tryp_SPc 83..317 CDD:238113 84/269 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.