DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPC2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313588.3 Gene:CLIPC2 / 1274460 VectorBaseID:AGAP004317 Length:383 Species:Anopheles gambiae


Alignment Length:389 Identity:127/389 - (32%)
Similarity:181/389 - (46%) Gaps:67/389 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 ALPGIQILLLIASVSVVTEYC--DNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFND--IVC 63
            ||..|..|..:.:.|...|.|  .|..|.|:..  :.|..:.....:    ||.|...:.  :||
Mosquito    15 ALSAIFFLGSVLAASNEGESCAYGNEPGICQGY--NLCRPLLEKSRI----VKICGYTSQQAVVC 73

  Fly    64 CPIPLDHQNLKPAEQTRPFEKQCKQYNEV---------------------RSACQSTP-FIVGGT 106
            |  |||::  :..:|.....::|:.|...                     |:.|.:.. .|||||
Mosquito    74 C--PLDYR--ERLQQLNDPNQRCRDYQSASNSGLLFGSLAVGSSVVKLKPRAQCPTDQNLIVGGT 134

  Fly   107 KASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKF 171
            .|...|||.||.:.  .|:::.:.: :.||.:::..::|:|||||||              |...
Mosquito   135 AARFGEFPHMARLA--MPDENGAMV-FRCGATLISEQWVMTAAHCLE--------------SQTI 182

  Fly   172 VVRLGEL-DYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            ||||||| :.|....|.:  |.:|...|.||.|    :.:...|||||::|.|...|:..:...|
Mosquito   183 VVRLGELKEGNDEFGDPV--DVQVTRIVKHPNY----KPRTVYNDIALLKLARPVTFSMRIRPAC 241

  Fly   236 LPPDSGNDVQQVTAAGWGFT-ADGVKSSHLLKVNLQRFSDEVC----QKRLRFSIDTR-TQFCAG 294
            |...|..|..:..|.|:|.| |.|..|..||||:|..|:...|    |:..|.....| :..|||
Mosquito   242 LYGSSTVDRTKAVAIGFGSTEAYGAASKELLKVSLDVFTTAACSVFFQRNRRVPQGLRESHLCAG 306

  Fly   295 SMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIVW 358
            .:|...|||.||||||:.:......|:.|:|||.|:|:.|||. .|.:||:|..|.||||.|||
Mosquito   307 FLSGGRDTCTGDSGGPLQISSEDEACVAQIIGITSFGIGCGST-TPGIYTRVSEYIDWIEGIVW 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 99/260 (38%)
Tryp_SPc 102..353 CDD:214473 96/257 (37%)
CLIPC2XP_313588.3 Tryp_SPc 130..367 CDD:238113 99/260 (38%)
Tryp_SPc 130..364 CDD:214473 96/257 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.