DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP003691

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313476.4 Gene:AgaP_AGAP003691 / 1274366 VectorBaseID:AGAP003691 Length:831 Species:Anopheles gambiae


Alignment Length:248 Identity:65/248 - (26%)
Similarity:107/248 - (43%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 PNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDAL 188
            |..:::.....|.||::.||||||||:||.           .::...:.:.:|:.:......:..
Mosquito   271 PKTAETGSKRHCYGSLIAPKFVLTAANCLR-----------QYEVDGYTIEMGQYNVYYPVQENS 324

  Fly   189 VQ---DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKA-EFNDHVAAVCLPPDSGNDVQQVTA 249
            ::   :.:.::|  ||.:|...    ..||:||:|:.:.. .||..|...|:.|.....|.:...
Mosquito   325 IRVRTEAKKIHY--HPEFDAAT----LANDVALLEIVKPLYTFNKTVLPACIWPWDKLPVDEYQT 383

  Fly   250 AGW-GFTADGVKSSHLLKVNLQRFS-----DEVCQKRLRFSIDTRTQFCAGSMSS-QADTCNGDS 307
            .|: .|.....:|   ::.| |.|:     ||...|      ..:.|||||..:: ...:|:...
Mosquito   384 NGYVPFNESDDES---VRTN-QFFATANVYDECLDK------VPQHQFCAGFPTALSPKSCHNSV 438

  Fly   308 GGPIFVQHPLYPC---LKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            |..  :...||..   ...:..|.|.|..||. .||:||||:..|..||:|||
Mosquito   439 GSA--MSRSLYALGRYFDYIFAINSKGENCGF-NLPTVYTKIAPYVQWIDSIV 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 62/245 (25%)
Tryp_SPc 102..353 CDD:214473 60/242 (25%)
AgaP_AGAP003691XP_313476.4 Tryp_SPc 80..>152 CDD:304450
Tryp_SPc 276..484 CDD:214473 59/237 (25%)
Tryp_SPc 281..487 CDD:304450 61/235 (26%)
CLIP 506..554 CDD:197829
Tryp_SPc 600..820 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.