DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPC7

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_313474.4 Gene:CLIPC7 / 1274364 VectorBaseID:AGAP003689 Length:594 Species:Anopheles gambiae


Alignment Length:360 Identity:88/360 - (24%)
Similarity:147/360 - (40%) Gaps:74/360 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 DNGTGECKELTPSD----------CPVIFYNQHLIG-----AEVKYCD-EFNDIV-CCPIPLDHQ 71
            |.|.|| |.:|..|          ||.::  :.|.|     |.::.|. |..|:: ||       
Mosquito   263 DAGLGE-KCITKDDKEGVCLRLEACPQVY--RQLKGKGRNLAALQQCGFEGGDVLNCC------- 317

  Fly    72 NLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCG 136
              .|.:..:..:||.| ...:|...:....:....:.:.||....:.:.....::.|.    :|.
Mosquito   318 --TPDDMLKADDKQAK-LQSIRHEIEHCHELYDVHRRTTKEQQLHSQLALILGDEGKV----ECV 375

  Fly   137 GSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTT--DDALVQDFRVVNYVV 199
            |:::..:||||||.|:...:||.           ..|:||      ||  |:...|...||:.||
Mosquito   376 GTLIAKQFVLTAAQCVLRVKSKT-----------ITVQLG------TTGKDEWFNQTRSVVSTVV 423

  Fly   200 HPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQVTAAGW-----GFTADGV 259
            ||.:|......    :|||:.||......:|....|:.|:......|:.:.|:     ...||.|
Mosquito   424 HPMFDHHTNHY----NIALLALDAPVAITEHTVPACMWPEKDRMPAQLISTGYDAASDAIIADTV 484

  Fly   260 KSSHLLKVNLQRFSD----EVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPC 320
            ...:.:...|:.:|:    |.|     ...||...:|....::.|::..| ..|.:::.....| 
Mosquito   485 NPLYYIDCRLKYYSNLTLTEAC-----VLPDTDISYCGDEPTACAESGTG-LYGTVYMTSDWRP- 542

  Fly   321 LKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIES 355
            :..|:||.|.|..| :|..|::||:|..|..||.:
Mosquito   543 VNFVVGIYSNGAQC-AQHRPAIYTRVSEYYPWIRA 576

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 66/265 (25%)
Tryp_SPc 102..353 CDD:214473 64/261 (25%)
CLIPC7XP_313474.4 CLIP 270..318 CDD:197829 12/58 (21%)
Trypsin 353..574 CDD:278516 64/253 (25%)
Tryp_SPc 374..575 CDD:304450 62/229 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D476534at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24258
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.