DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP003248

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312959.4 Gene:AgaP_AGAP003248 / 1273921 VectorBaseID:AGAP003248 Length:296 Species:Anopheles gambiae


Alignment Length:262 Identity:81/262 - (30%)
Similarity:128/262 - (48%) Gaps:44/262 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            |.|:||||...:||.|   :::.||||:::.::|:|||||:.:       |...:...:  :|||
Mosquito    58 EAPWMALIEYWKPNGS---LSYLCGGSLINERYVVTAAHCVTS-------LPQGWTVHR--IRLG 110

  Fly   177 ELDYNSTTD-------DALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAV 234
            |.|.:::.|       ||.: |..|....||..|  :...:..:|||||:.|||:..:.:.||.:
Mosquito   111 EWDLSTSEDCDHSRCNDAPI-DVAVDKITVHEDY--KSPSRNHRNDIALIRLDRQMHYTETVAPI 172

  Fly   235 CLPPDSGNDVQQ---VTAAGW---GFTADGVKSSHLLK--VNLQRFSDEVCQKRLRFSIDTRTQF 291
            |||.:.....|:   :.:.||   .|...|.|...:.:  |:.|..|....|..:..:   .||.
Mosquito   173 CLPQNGPLQTQRYRTMHSVGWIEENFGPIGGKKLQVEQDLVDFQNCSSNYLQASIALA---DTQL 234

  Fly   292 CAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGIVSY-GLVCGSQGLPSVYTKVHLYTDWI 353
            |   ::.|.|.....:|||:.  :....|     :.|:.|: |...|:..||:|||.|..|.|||
Mosquito   235 C---VAQQKDNRIDIAGGPLMQRIAGHWY-----LFGVASFGGRNYGTVELPNVYTNVMEYVDWI 291

  Fly   354 ES 355
            ||
Mosquito   292 ES 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/262 (31%)
Tryp_SPc 102..353 CDD:214473 77/258 (30%)
AgaP_AGAP003248XP_312959.4 Tryp_SPc 53..291 CDD:214473 77/258 (30%)
Tryp_SPc 54..294 CDD:238113 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.