DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB2

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312956.3 Gene:CLIPB2 / 1273920 VectorBaseID:AGAP003246 Length:355 Species:Anopheles gambiae


Alignment Length:385 Identity:123/385 - (31%)
Similarity:182/385 - (47%) Gaps:75/385 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLIASVSVVTEY---CDN---GTGECKELTPSDCP---VIFYNQHLIGAEVKY-----CDEF- 58
            ::|.:..|||..|.   |.|   .||:|  :...:|.   .|:..:.....|.::     |.|. 
Mosquito     9 LVLALFGVSVALEQGQRCVNPARQTGKC--VLVRECASLLAIYSKRFTTPEETQFLASSRCGEIG 71

  Fly    59 -NDIVCCPIPLDHQNLKPAEQTR----PFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMAL 118
             ..:|||         ...:|||    |...:|        ..|.|..|:||.....:|||:.||
Mosquito    72 RKTLVCC---------ASEQQTRTSSFPTSPEC--------GIQVTDRIIGGQTTELEEFPWTAL 119

  Fly   119 IGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNST 183
            |...:|.   :..::.|||::::.:::||||||::: ..:..:|:.        |||||.|.::.
Mosquito   120 IEYRKPG---NQYDFHCGGALINARYILTAAHCVQS-LPRGWQLNG--------VRLGEWDLSTA 172

  Fly   184 TD--DALVQ----DFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP---PD 239
            .|  |.:..    |..:.::|.|.|||..|  ....|||||:.|.:....::.:..:|||   |.
Mosquito   173 NDCSDGICSAGPIDLEIESFVAHAGYDAAD--TAHTNDIALIRLRQDVASSEMIRPICLPLTEPQ 235

  Fly   240 -SGNDVQQVT-AAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLR-FSIDTR-TQFCAGSMSSQA 300
             |.|.|..|: |||||.|.....|...|||.|.......|::..| .:|..: :|.|||.:..: 
Mosquito   236 RSRNRVGTVSFAAGWGKTESASASERKLKVELTVQDPSRCRQIYRGINIALKASQMCAGGLQGK- 299

  Fly   301 DTCNGDSGGPIFVQH--PLYPCLKQVIGIVSYGL-VCGSQGLPSVYTKVHLYTDWIESIV 357
            |||.||||||:..:.  ..|     :||:||:|| .||:.|.|.|||.|..|.|||||.|
Mosquito   300 DTCTGDSGGPLMAKSAGAWY-----LIGVVSFGLSKCGTAGYPGVYTNVVEYLDWIESNV 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 96/269 (36%)
Tryp_SPc 102..353 CDD:214473 93/266 (35%)
CLIPB2XP_312956.3 CLIP 26..78 CDD:288855 11/53 (21%)
Tryp_SPc 102..350 CDD:214473 93/267 (35%)
Tryp_SPc 103..353 CDD:238113 96/269 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.