DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB10

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312744.4 Gene:CLIPB10 / 1273735 VectorBaseID:AGAP003058 Length:362 Species:Anopheles gambiae


Alignment Length:390 Identity:122/390 - (31%)
Similarity:177/390 - (45%) Gaps:81/390 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQILLLIASVSVV--TEYC---DNGTGECKELTPSDCPVI---FYNQH--LIGAEVKY-----CD 56
            :..:||:|.::||  .|.|   |:..|.|..:  ..||.:   |:|..  |...|:.|     |.
Mosquito     5 VDCVLLLAFIAVVRGQEACRTPDHRDGVCHPV--QQCPSVRDEFFNSDRVLSEDEIDYLRKLQCK 67

  Fly    57 EFNDIVCCPIPLDHQNLKPA------EQTRPFEKQCKQYNEVRSACQSTPF---IVGGTKASGKE 112
            ..:..:|||..:...:..|.      ...:.||            |.....   |:||...:..|
Mosquito    68 TKDVTICCPDGVTTVDRNPTAVRDGLPNPKAFE------------CGLDTLADRIIGGNYTAIDE 120

  Fly   113 FPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDE-SKAERLDPNFDSPKFVVRLG 176
            ||:.||:   .....|.:..:.||||:::.::||||||||...: .:.|||        ..||||
Mosquito   121 FPWYALL---EYQSKKGERAFKCGGSLINGRYVLTAAHCLANKKLDEGERL--------VNVRLG 174

  Fly   177 ELDYNSTTDDALV-----------QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDH 230
            |  ||:.||....           |:|.:...:||||||.....|  .:||||:.|||....|:.
Mosquito   175 E--YNTATDTDCADGNPDDCADPPQNFGIEAQIVHPGYDKNGPYQ--HHDIALIRLDRDVTMNNF 235

  Fly   231 VAAVCLPPDSGNDVQ---QVTAAGWGFTA----DGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTR 288
            |:.||||||......   .|||.|:|.|.    .|:|.    |.....|:.|.|.|:.:......
Mosquito   236 VSPVCLPPDDFPPTSPGLNVTAVGFGHTGRQRHSGIKK----KAQFPVFAQEECDKKWKNIEVIG 296

  Fly   289 TQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            .|.|||.:.. .|:|:||||||:.|:.  :..:::  |::|:|..|..:|.|.|||:|..|.|||
Mosquito   297 EQLCAGGVFG-IDSCSGDSGGPLMVKR--FYWIQE--GVISFGNQCALEGWPGVYTRVSSYLDWI 356

  Fly   354  353
            Mosquito   357  356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 97/271 (36%)
Tryp_SPc 102..353 CDD:214473 95/269 (35%)
CLIPB10XP_312744.4 CLIP 23..76 CDD:197829 13/54 (24%)
Tryp_SPc 109..356 CDD:214473 95/270 (35%)
Tryp_SPc 110..359 CDD:238113 97/271 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.