DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPD1

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312523.4 Gene:CLIPD1 / 1273538 VectorBaseID:AGAP002422 Length:435 Species:Anopheles gambiae


Alignment Length:365 Identity:105/365 - (28%)
Similarity:162/365 - (44%) Gaps:84/365 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IQILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKY-----CDEFNDIVCCPI 66
            :|.|.::..:||         |.|       ||.:..:.:  |.|...     .|.::|:     
Mosquito   131 LQHLCIVEGISV---------GIC-------CPDVVQDGN--GPEFSVRLPATADSYDDV----- 172

  Fly    67 PLDHQNLKPAEQ---TRPFEKQC----KQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRP 124
              |.....|..:   .||.|:.|    ||.::          |.||..|...|:|:|..:.:.|.
Mosquito   173 --DGLGDGPTARDATVRPEERGCGLSTKQLSK----------IAGGRPADSNEWPWMVALVSSRA 225

  Fly   125 NKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALV 189
            :        .|||.::..:.|||||||:           .|....:|||||||.|:.. .::...
Mosquito   226 S--------FCGGVLITDRHVLTAAHCV-----------MNLKLTQFVVRLGEYDFKQ-FNETRY 270

  Fly   190 QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP-DSGNDVQQVTAAGWG 253
            :||||.....|..:|    :..::||||:::|.:.:.||.::..:|:|| |......|....|||
Mosquito   271 RDFRVAEIRAHADFD----QISYENDIAMLKLIQPSFFNSYIWPICMPPLDDAWTGYQAVVTGWG 331

  Fly   254 FT-ADGVKSSHLLKVNLQRFSDEVCQK----RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFV 313
            .. ..|..|..|::|.:..:|::.||:    |:     ..|..|||......|:|.||||||:.:
Mosquito   332 TQFFGGPHSPVLMEVRIPIWSNQECQEVYVNRI-----YNTTLCAGEYDGGKDSCQGDSGGPLMI 391

  Fly   314 QHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |.|....  .|:||||:|:.||....|.:||:|..|..||
Mosquito   392 QLPNRRW--AVVGIVSWGIRCGEANHPGIYTRVSSYVRWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 85/258 (33%)
Tryp_SPc 102..353 CDD:214473 83/256 (32%)
CLIPD1XP_312523.4 CLIP 102..147 CDD:197829 6/31 (19%)
Tryp_SPc 202..429 CDD:214473 83/267 (31%)
Tryp_SPc 203..432 CDD:238113 85/258 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.