DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPD4

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312102.4 Gene:CLIPD4 / 1273150 VectorBaseID:AGAP002811 Length:385 Species:Anopheles gambiae


Alignment Length:398 Identity:116/398 - (29%)
Similarity:176/398 - (44%) Gaps:104/398 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 SVVTEYCDNGT---GECKELTPSDCPVIFYNQ----HLIGAEVKYCDEFNDI--VCC-------- 64
            :||.|.|...:   |.|..:|  .||..|...    .|.||..:.|..|..|  |||        
Mosquito    25 AVVVEPCYTSSGVRGVCMSIT--SCPTAFQLNINPFSLFGAAPRGCQNFLGIGSVCCSRAVSSAG 87

  Fly    65 ----PIPLDHQNLKPAEQT---RPFEKQ-C----KQYNEVRSACQSTPFIVGGTKASGKEFPFMA 117
                |.|.......|..:|   :.||.. |    .::|.|          |||..|:...:|:||
Mosquito    88 QTSAPAPSRITTATPTARTTTVKTFEPDGCGVSDVEHNRV----------VGGVPAALNGWPWMA 142

  Fly   118 LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETD---------ESKAERLDPNFDSPKFVV 173
            |:|.   .::..|:::.||||::..:.|||||||:.:.         :::.|  ..:.|.|.:.|
Mosquito   143 LVGY---EEAFGDVDFRCGGSLITDRHVLTAAHCILSSLLVWMQHDMDNQTE--SAHVDVPVYKV 202

  Fly   174 RLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPP 238
            |...:::             |.:||.||.|||.|..    :|:|::.|....|||..:..:||| 
Mosquito   203 RSTSINF-------------VKSYVSHPSYDTFDGH----SDVAILFLTETVEFNARIKPICLP- 249

  Fly   239 DSGNDVQQVTA----------AGWGFTAD-GVKSSHLLKVNLQRFSDEVCQ---KRLRFSIDTRT 289
                .::.|.:          ||||.|.: |:::..|.::.:....:|.|.   |::|....|: 
Mosquito   250 ----TIEPVRSADFTGYNPFIAGWGRTKETGIEAKVLQELQIPILENEECSQLYKKIRKLYSTK- 309

  Fly   290 QF-----CAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQV----IGIVSYGLVCGSQGLPSVYTK 345
            ||     |||.:....|:|.||||||:.:.   |...|:.    |||||||:.|....||.|||:
Mosquito   310 QFDDAVLCAGFLEGGKDSCQGDSGGPLMLP---YLVNKKFHYFQIGIVSYGVGCARAELPGVYTR 371

  Fly   346 VHLYTDWI 353
            |..:.||:
Mosquito   372 VVTFVDWL 379

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 88/284 (31%)
Tryp_SPc 102..353 CDD:214473 87/282 (31%)
CLIPD4XP_312102.4 Tryp_SPc 126..378 CDD:214473 87/292 (30%)
Tryp_SPc 127..379 CDD:238113 88/292 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.