DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA15

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312096.5 Gene:CLIPA15 / 1273144 VectorBaseID:AGAP002815 Length:867 Species:Anopheles gambiae


Alignment Length:311 Identity:84/311 - (27%)
Similarity:137/311 - (44%) Gaps:49/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 PIPL---DHQNLKPAEQT-RPFEKQ----CKQYNEVRSACQSTPFIVGGTKASGKEFPF-MALIG 120
            |||:   ||.:..|.:.. .|..|:    .|.::..|..     .:|||......|:.: :||| 
Mosquito   583 PIPIIYHDHNDTVPEDLLHHPSVKENATLAKYWSHHRKG-----RVVGGEDGENGEWCWQVALI- 641

  Fly   121 THRPNKSKSDIN-WDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTT 184
                    :.:| :.||.:::..::|||||||:.......:.:         .||:|:.|.....
Mosquito   642 --------NSLNQYLCGAALIGTQWVLTAAHCVTNIVRSGDAI---------YVRVGDYDLTRKY 689

  Fly   185 DDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDV--QQV 247
            .....|..||....:|..:::    |...|||||::|..:||..|.|..||||....:..  ::.
Mosquito   690 GSPGAQTLRVATTYIHHNHNS----QTLDNDIALLKLHGQAELRDGVCLVCLPARGVSHAAGKRC 750

  Fly   248 TAAGWGFTAD-GVKSSHLLKVNLQRFSDEVCQKRL-----RFSIDTRTQFCAGSMSSQADTCNGD 306
            |..|:|:..: |.....:.:..:...||..|.:::     :..|...:.||||..... |.|.||
Mosquito   751 TVTGYGYMGEAGPIPLRVREAEIPIVSDAECIRKVNAVTEKIFILPASSFCAGGEEGN-DACQGD 814

  Fly   307 SGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .|||:..|...:   .::.|:||:|..||...:|.||.||..:..||..|:
Mosquito   815 GGGPLVCQDDGF---FELAGLVSWGFGCGRVDVPGVYVKVSSFIGWINQII 862

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/263 (28%)
Tryp_SPc 102..353 CDD:214473 71/260 (27%)
CLIPA15XP_312096.5 Tryp_SPc 622..858 CDD:214473 71/261 (27%)
Tryp_SPc 623..861 CDD:238113 73/263 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.