DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP002842

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_312070.5 Gene:AgaP_AGAP002842 / 1273118 VectorBaseID:AGAP002842 Length:282 Species:Anopheles gambiae


Alignment Length:280 Identity:91/280 - (32%)
Similarity:125/280 - (44%) Gaps:53/280 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSD----INWDCGGSVVHPKFVLTAAHCLETDESKAERL 162
            ||||..|:..|||.||::|.........|    ..|.|||:::..:||||||||..|..|     
Mosquito    26 IVGGDSATADEFPHMAVLGRSCLQADGGDCVDGYEWFCGGTLISDRFVLTAAHCAHTGMS----- 85

  Fly   163 DPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF--KNDIALVELDRKA 225
                 .|..||:||..|...   .||....|.|  |:||||.      |.  .|||||:.|:...
Mosquito    86 -----HPPTVVQLGAHDLRR---PALYVGVRDV--VLHPGYG------GVLAYNDIALIRLESPV 134

  Fly   226 EFNDHVAAVCLPPDSGNDVQQVTAAGWGFTADGVKSSH-------LLKVNLQRFSDEVC------ 277
            ..:...|.:........:|..: |.|||      |..|       |.:|.:....:..|      
Mosquito   135 ASSIQPALLWRSETIPENVPLI-ATGWG------KLGHFEDPSMILQRVQIPIVPNSQCNQLLYR 192

  Fly   278 QKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQ 337
            .:|||..: ..:|.|||..:...|||.||||||:.::.|....:.|     |:||.|.|.:||:.
Mosquito   193 SRRLRHGV-LPSQLCAGDPNGGKDTCEGDSGGPLQLKLPSARPIGQAYRYYVVGITSNGGICGTV 256

  Fly   338 GLPSVYTKVHLYTDWIESIV 357
            ..|.:||:|..|..||:.::
Mosquito   257 DRPGLYTRVSSYAGWIDQVL 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 91/277 (33%)
Tryp_SPc 102..353 CDD:214473 89/274 (32%)
AgaP_AGAP002842XP_312070.5 Tryp_SPc 26..275 CDD:238113 91/277 (33%)
Tryp_SPc 26..272 CDD:214473 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.