DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA8

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_311445.2 Gene:CLIPA8 / 1272532 VectorBaseID:AGAP010731 Length:369 Species:Anopheles gambiae


Alignment Length:403 Identity:105/403 - (26%)
Similarity:155/403 - (38%) Gaps:98/403 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLIASVSVVTEYCDN-GTGEC---KELTPSDCPVIF-----------------YNQHLI---G 49
            ::||.|...:|.....| |:.|.   |.|.  :||..|                 .||.:|   .
Mosquito    11 VVLLYAQRMIVPSSAQNDGSDELQVKKRLL--ECPGGFCSPKYLCPNGTYNEANAQNQEIIMLRF 73

  Fly    50 AEVKYCDEFNDIVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGG--------- 105
            .|...|.::..:.|.........|  .....|.|..|...|.            ||         
Mosquito    74 GEEDVCQDYMQVCCSNATSMRYEL--VTNNEPVEYGCGISNP------------GGLIYQVEGNR 124

  Fly   106 TKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPK 170
            |.|...|||::..|.....:.::....:..||:::||:||:||||..    :|.|.|        
Mosquito   125 TYAQYGEFPWVVAILEAFYSSNEQQFTYVGGGTLIHPRFVVTAAHIF----NKTENL-------- 177

  Fly   171 FVVRLGELDYNSTTDDALVQDFRV-VNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAV 234
             |...||.|.|...:....|:..: ...:|||.|::    .|..|||||.:|.:...::.|:..:
Mosquito   178 -VASFGEWDMNRDENVYPKQNIDIDRTIIVHPEYNS----VGLLNDIALAQLKQNVVYDKHIRPI 237

  Fly   235 CLP-PDSGNDVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQK-----------RLRFSID 286
            ||| |....|.|...:.|||..|.....:::|| |:|...:...|:|           ||..|: 
Mosquito   238 CLPNPTDRFDDQLCISTGWGIEALTSAYANVLKRVDLPVIARASCKKLFAETRLGPFFRLHKSV- 301

  Fly   287 TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQGLPSVYTKV 346
                .|||. ...||.|:||.|..:       .|..:     :.||||:||.|..|.:|..|..|
Mosquito   302 ----LCAGG-EEGADMCDGDGGSGL-------ACPNESGAYVLAGIVSWGLSCHQQNVPGAYVNV 354

  Fly   347 HLYTDWIESIVWG 359
            ..:..||.:.:.|
Mosquito   355 ARFVTWINATIEG 367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/281 (29%)
Tryp_SPc 102..353 CDD:214473 79/278 (28%)
CLIPA8XP_311445.2 Tryp_SPc 127..364 CDD:238113 78/266 (29%)
Tryp_SPc 127..361 CDD:214473 76/263 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.