DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP010730

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_311444.4 Gene:AgaP_AGAP010730 / 1272531 VectorBaseID:AGAP010730 Length:256 Species:Anopheles gambiae


Alignment Length:265 Identity:78/265 - (29%)
Similarity:119/265 - (44%) Gaps:46/265 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            |:|::..|...:..::.|. ::.|||:::|.:.|:|.||  .|| .|.:          .|.|.|
Mosquito     7 EYPWVVYILALKKQEANSG-DFVCGGTLIHSRLVVTTAH--NTD-GKTD----------LVARFG 57

  Fly   177 ELDYNSTTD----DALV--QDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVC 235
            |.|.::|.:    ..|.  ||..|...:.||.|....    .:|||||:.|....::..|:..:|
Mosquito    58 EWDISTTKEPFPQQCLFPHQDIDVAEVIKHPQYVFNP----IQNDIALLVLAENVQYAAHIRPIC 118

  Fly   236 LPPDSGNDV-QQVTAAGWGFTADGVKSSHLLKVNLQRFSDEVCQKRLRFS-----IDTRTQF-CA 293
            ||..:...| |:..:.||| ...||.::.:.|:.|.......|.:.||::     ...|..| ||
Mosquito   119 LPQPTDEFVGQRCVSNGWG-KERGVYANVMKKLTLPVIGRANCTRMLRYAGLGPFYTLREGFLCA 182

  Fly   294 GSMSSQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWI 353
            |. ....|.|.||.|.|:       .|..:     :.||||:|:.||....|.||..|:.|..|:
Mosquito   183 GG-EVAVDMCKGDGGSPL-------ACQTESGTYVLAGIVSWGIGCGGFNTPGVYVAVNRYVQWL 239

  Fly   354 -ESIV 357
             |.||
Mosquito   240 NEHIV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/262 (29%)
Tryp_SPc 102..353 CDD:214473 74/258 (29%)
AgaP_AGAP010730XP_311444.4 Tryp_SPc 7..242 CDD:238113 75/261 (29%)
Tryp_SPc 7..238 CDD:214473 74/257 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.