DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPC10

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_310506.4 Gene:CLIPC10 / 1271650 VectorBaseID:AGAP000572 Length:380 Species:Anopheles gambiae


Alignment Length:409 Identity:121/409 - (29%)
Similarity:177/409 - (43%) Gaps:97/409 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MYALPGIQILLLIASVSVVT--------EYCD--NGT-------GECKELTPSDCPVIFYNQHLI 48
            :.|:.|..:|||.|...::.        :.|:  |||       .:|:.......|:     |  
Mosquito    15 LLAVLGGHVLLLAADQILLEDDPMLYEGDACELRNGTAGLCRPANQCEWAQERPWPL-----H-- 72

  Fly    49 GAEVKYCDEFND---IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASG 110
              |:..| .||.   |||||:.|:.:........|...:||:|:   .:.......|..|..|..
Mosquito    73 --ELVTC-SFNQSLPIVCCPVRLEPRLQGGTVAKRISVRQCEQF---PNGTGLADHIFNGVAAQF 131

  Fly   111 KEFPFMALIGTHRPNKSKSDIN--WDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVV 173
            .|||:||.:|...||.:::.:.  :.||.|::..:|:|||||||.             :.|.| .
Mosquito   132 GEFPYMAALGYGAPNGTEAGLPSLFRCGASLISSRFLLTAAHCLR-------------ERPVF-A 182

  Fly   174 RLG--ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN-DHVAAVC 235
            |||  ||....|.|:.|  |..:.....||.|....    ::|||||:||......: ..|..||
Mosquito   183 RLGVLELQPARTVDEPL--DIAIRQATPHPDYHAVT----YQNDIALLELAEPVTGDWPFVEPVC 241

  Fly   236 LPPD-SGNDV-----QQVTAAGWGF--TADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDTRT--- 289
            |..: :|..:     |.::..|||.  ..|...::.|:|.|:.....:.|...:     .||   
Mosquito   242 LYTNATGGGLEALAGQPLSVQGWGTQQPGDTEPAARLMKANVSLVERDACAASI-----PRTRRN 301

  Fly   290 -------QFCAGSMSSQ----ADTCNGDSGGPIFV----QHPLYPCLKQVIGIVSYGLVCGSQGL 339
                   |.||...:.|    ||||.||||||:.:    :|.|       :||.|.|..|||. :
Mosquito   302 PTGLHPGQLCALGRNEQNETVADTCPGDSGGPLALNVDGRHYL-------VGITSSGYSCGSP-I 358

  Fly   340 PSVYTKVHLYTDWIESIVW 358
            |.:||:|..|.||:|||||
Mosquito   359 PGIYTEVARYLDWVESIVW 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 90/284 (32%)
Tryp_SPc 102..353 CDD:214473 88/281 (31%)
CLIPC10XP_310506.4 CLIP 45..89 CDD:197829 14/53 (26%)
Tryp_SPc 122..372 CDD:214473 88/282 (31%)
Tryp_SPc 123..375 CDD:238113 90/284 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.