DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPC4

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_310504.4 Gene:CLIPC4 / 1271649 VectorBaseID:AGAP000573 Length:376 Species:Anopheles gambiae


Alignment Length:396 Identity:114/396 - (28%)
Similarity:173/396 - (43%) Gaps:91/396 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLIASVSVVTEYCDN---------------------GTGECKELTPSDCPVIFYNQHLIGAEV 52
            :|:|:..:..||....|                     .||.|::  .:|||      ..|.|..
Mosquito    26 LLVLVILLGAVTRSAGNFSFPTDPDILYEGDKCGLPGMRTGTCQK--AADCP------QGIRANG 82

  Fly    53 KYCDEF--ND-IVCCP--IPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPFIVG-GTKASGK 111
            ..| ||  || :||||  .|............|..:::|:::..  ::......|.| ..:|...
Mosquito    83 ARC-EFSGNDPVVCCPTEAPGTGDGTSNRFTARIAKQECERFTS--ASANIIDHISGRAIEALRG 144

  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            ||||:||: ..|..:.:......||.|::.|:|:|||||||:.       |:|      ..|.:|
Mosquito   145 EFPFVALV-NFRGEEGEEVKLTRCGASLIAPRFLLTAAHCLKD-------LNP------VTVEIG 195

  Fly   177 ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCL---PP 238
            .:..:.|..|    ::.:....:|.|:.:.      :|||||:||.....:...|..:||   .|
Mosquito   196 FIQLSDTEKD----EYEIKQVHLHEGHKSR------RNDIALIELKNNVTYKQDVGPICLNTDRP 250

  Fly   239 DSGNDVQQVTAAGWGFTADGVKSSHLLKVN---------LQRFSDEVCQKRLRFSIDTRTQFCA- 293
            :.|..: .:|..|||...||.::..|:|..         :|||.|  .::|:....|   |.|| 
Mosquito   251 EIGPSI-NLTVMGWGADGDGQRADKLMKGTVYEIPLDECVQRFRD--AKQRISLGED---QLCAL 309

  Fly   294 GSM--SSQADTCNGDSGGPIF--VQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLYTDWIE 354
            |..  ....|.|.||||||:.  |:...|     ::|:||.|.|||. .||.:||:|..|.:|||
Mosquito   310 GEKVNDETTDACQGDSGGPLVMTVRQKFY-----LVGVVSTGAVCGG-SLPGIYTRVSRYLEWIE 368

  Fly   355 SIVWGN 360
            ..|||:
Mosquito   369 QRVWGS 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 86/271 (32%)
Tryp_SPc 102..353 CDD:214473 83/268 (31%)
CLIPC4XP_310504.4 Tryp_SPc 140..369 CDD:238113 83/264 (31%)
Tryp_SPc 140..367 CDD:214473 81/262 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.