DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP003748

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_310280.7 Gene:AgaP_AGAP003748 / 1271480 VectorBaseID:AGAP003748 Length:547 Species:Anopheles gambiae


Alignment Length:283 Identity:105/283 - (37%)
Similarity:145/283 - (51%) Gaps:54/283 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 FIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPN 165
            ||.||.:|..||||.||.||......|...:.:.||||::..|:|||||||...||         
Mosquito    53 FIFGGRRAFLKEFPHMAAIGWTDKTVSPPVVQYKCGGSLIAAKYVLTAAHCKVDDE--------- 108

  Fly   166 FDSPKFV---------VRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKN----DIA 217
                |:|         ||||:.:..:|.||...|.|::|::.||        |:..||    |||
Mosquito   109 ----KYVFIRVIPPDTVRLGDTNLATTEDDETAQQFKIVSFAVH--------EKFKKNRKYYDIA 161

  Fly   218 LVELDRKAEFNDHVAAVCL-PPDSGNDV-QQVTAAGWGFT--ADGVKSSHLLKVNLQRFSDEVCQ 278
            |:||||:|:||..|..:|| |.|:.::. ..:.|.|:|||  ..|: |..|.||:|..:..:.|.
Mosquito   162 LIELDREAKFNTAVCPICLWPLDNIHEYSSSLRAIGFGFTTYTSGM-SPTLQKVSLNYYDSDSCN 225

  Fly   279 K------RLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQ-HPLYPCLKQVIGIVSYGLVC-- 334
            .      |||:.: |..|||  :.:...|.|.||||||:.:. ..:...:..:.|:||:|..|  
Mosquito   226 NELPKDARLRYGL-TSDQFC--TKTPHKDACLGDSGGPLQIDLSDVTRTIPYLTGVVSFGTGCWD 287

  Fly   335 GSQGLPSVYTKVHLYTDWIESIV 357
            ||.|   |||||..|.:||...|
Mosquito   288 GSMG---VYTKVASYINWIRERV 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 103/279 (37%)
Tryp_SPc 102..353 CDD:214473 101/276 (37%)
AgaP_AGAP003748XP_310280.7 Tryp_SPc 54..305 CDD:238113 103/278 (37%)
Tryp_SPc 54..303 CDD:214473 101/276 (37%)
Trypsin 316..521 CDD:278516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D105391at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.