DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPB14

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309876.4 Gene:CLIPB14 / 1271130 VectorBaseID:AGAP010833 Length:375 Species:Anopheles gambiae


Alignment Length:418 Identity:121/418 - (28%)
Similarity:175/418 - (41%) Gaps:122/418 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 YALPGIQILLLIASVSVVTEYCDNGTGE----CKELTPS----------DCPVI--------FYN 44
            |...|:..||:||        .|.|.|:    |  .||:          :|..:        |.:
Mosquito     6 YVACGLLCLLVIA--------IDQGHGQEHKPC--TTPNGTAGRCVRVRECGYVLDLLRKDLFAH 60

  Fly    45 QHLIGAEVKYCDEFND---IVCCPIPLDHQNLKPAEQTRPFEKQCKQYNEVRSACQSTPF---IV 103
            ...:..|...|....|   :||||..::..|                       |..:.|   |:
Mosquito    61 SDTVHLEGLQCGTRPDGGALVCCPAFVNEPN-----------------------CGPSVFGVRII 102

  Fly   104 GGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDS 168
            ||......|||:|||:.....|:.   |:.:||.|:|..:|||:||||....:||..::..    
Mosquito   103 GGNDTELGEFPWMALLRFQARNRK---IHGNCGASLVSKRFVLSAAHCFTAAKSKGWKIHS---- 160

  Fly   169 PKFVVRLGE---LDYNSTTDDALV---------QDFRVVNYVVHPGYDTEDEEQGFK-NDIALVE 220
                ||:.|   :::..:.|...|         :|:.|..:|.||.|..   ..|.. |||.|:|
Mosquito   161 ----VRVAEWNFMNHRGSKDCKQVKGYDVPICRKDYDVARFVQHPEYRV---NAGVHVNDIVLIE 218

  Fly   221 LDRKAEFNDHVAAVCLPPDSGNDVQQV------------TAAGWGFTADGVKSS----HLLKVNL 269
            |....|:|..||.:|||  ..||..|:            ||||||.|..|.:|:    .|.::||
Mosquito   219 LAADVEYNVFVAPICLP--VSNDTAQLPWGSSDDPEIEYTAAGWGSTESGKESTGMSYQLKQINL 281

  Fly   270 QRFSDEVCQKRLRFSIDTRT-----QFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGI 327
            :.|:.|.|:|  .|.:.:..     ..|||.:..: |||:||||||:.  |....|     :.||
Mosquito   282 RAFNKERCKK--LFQVPSGVGVGLGHICAGGIRDE-DTCHGDSGGPLMEAVGGVWY-----LAGI 338

  Fly   328 VSYGLV-CGSQGLPSVYTKVHLYTDWIE 354
            .|:|.. ||..|:|.|||.:..|..|:|
Mosquito   339 TSFGWPRCGRDGVPGVYTNISHYMGWLE 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 97/290 (33%)
Tryp_SPc 102..353 CDD:214473 95/287 (33%)
CLIPB14XP_309876.4 CLIP 30..83 CDD:314844 9/54 (17%)
Tryp_SPc 101..367 CDD:238113 97/290 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25778
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.