DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA9

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309727.4 Gene:CLIPA9 / 1270989 VectorBaseID:AGAP010968 Length:361 Species:Anopheles gambiae


Alignment Length:392 Identity:110/392 - (28%)
Similarity:164/392 - (41%) Gaps:79/392 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 PGIQILLLIAS----VSVVT--EYCDNGTGECKELTPS----DCPVIFYNQHLIGAEVKYCDEFN 59
            |.:.|||.:|:    .:|:|  :.|..|....|.|.|:    |.|:  ....|:...|   ||.|
Mosquito     4 PSVIILLSVAAHVTKANVITQSDVCKGGLCLPKHLCPTGRLEDGPL--QQGELVTLNV---DEEN 63

  Fly    60 DIVC------CPIPLDHQNLKPAEQTRPFEKQCKQ-------YNEVRSACQSTPFIVGGTKASGK 111
              ||      |.|.....:....::.:..:.||..       || |.|..         |.|:..
Mosquito    64 --VCGDFMKKCCIGASSADGVMIQEAQTADVQCGSPVTFPLVYN-VESNL---------TYANYG 116

  Fly   112 EFPFMALIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLG 176
            |||:...|.....:.::..:....|||::||||||||||.|:..:             ::|.|.|
Mosquito   117 EFPWTVAIFNISFSANEMKLTLVGGGSLIHPKFVLTAAHTLKKPD-------------RYVARFG 168

  Fly   177 ELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP-PDS 240
            |...||..:....||..:..:::||.|   .:....:|||||..|.|...:.:|:..:||| |..
Mosquito   169 EWSINSDAEIYPSQDIGIEEHIIHPSY---RDSCLLENDIALAVLKRNVIYTEHIRPICLPSPTD 230

  Fly   241 GNDVQQVTAAGWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLR-------FSIDTRTQFCAGSMS 297
            ..|.|:..|.|||......:.:.::| :.|.....:.||...|       |.:. |:..|||...
Mosquito   231 VFDGQRCIATGWGLDVRTQQPAPIMKRIELPVVPRDRCQLLYRRAEVDYSFKLH-RSMMCAGGEV 294

  Fly   298 SQADTCNGDSGGPIFVQHPLYPCLKQ-----VIGIVSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            .: |||:.|.|.|:       .|.|:     |.||.|:||.||....|.:|..|..:..||...:
Mosquito   295 GE-DTCDQDGGTPL-------ACKKEDGSYVVAGITSWGLDCGRVDAPGIYVDVAKFACWINDTI 351

  Fly   358 WG 359
            .|
Mosquito   352 EG 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/267 (30%)
Tryp_SPc 102..353 CDD:214473 78/264 (30%)
CLIPA9XP_309727.4 Tryp_SPc 113..350 CDD:238113 79/261 (30%)
Tryp_SPc 113..347 CDD:214473 77/258 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.