DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP006707

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309036.1 Gene:AgaP_AGAP006707 / 1270350 VectorBaseID:AGAP006707 Length:255 Species:Anopheles gambiae


Alignment Length:266 Identity:72/266 - (27%)
Similarity:118/266 - (44%) Gaps:59/266 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMA--LIGTHRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            :|||..|.....|:..  .|..|..|         ||||:::.::|||||||:...|....::..
Mosquito    31 VVGGEVAKNGSAPYQVSLQIPGHGHN---------CGGSLLNSRWVLTAAHCIVGHEPTNIQVLV 86

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
            ..:|.|...:|.:.|                 .:.|..|.:.:    |:|||.|:.|..:.:|::
Mosquito    87 GTNSLKEGGQLYKPD-----------------KLFHHNYASPE----FRNDIGLIRLKEEVQFSE 130

  Fly   230 HVAAVCLPPDSGNDVQQVTAA-------GWGFTADGVKSSHLLK-VNLQRFSDEVCQKRLRF--S 284
            .|.::       ...:||..|       |||.|:.|.....||: :|:...::|.|:.:..:  .
Mosquito   131 IVQSI-------EYSEQVVPANVTVRLTGWGRTSAGGSVPTLLQSLNVVTLTNEDCKAKSLYPEH 188

  Fly   285 IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKVHLY 349
            :|. ...|..|.|.:. .||||||||:..:..|       :|:|::|:.|| .|.|..:.:|..|
Mosquito   189 VDV-GHLCTLSRSGEG-ACNGDSGGPLVYEGKL-------VGVVNFGVPCG-LGYPDGFARVSYY 243

  Fly   350 TDWIES 355
            .|||.:
Mosquito   244 HDWIRT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/266 (27%)
Tryp_SPc 102..353 CDD:214473 70/262 (27%)
AgaP_AGAP006707XP_309036.1 Tryp_SPc 30..247 CDD:214473 70/262 (27%)
Tryp_SPc 31..250 CDD:238113 72/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.