DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CTR1_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309033.2 Gene:CTR1_ANOGA / 1270348 VectorBaseID:AGAP006709 Length:259 Species:Anopheles gambiae


Alignment Length:281 Identity:73/281 - (25%)
Similarity:117/281 - (41%) Gaps:78/281 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            :|||..|.....|:.  :....|       .|  :||||:::.::||||||||..          
Mosquito    33 VVGGEVAKNGSAPYQ--VSLQVP-------GWGHNCGGSLLNDRWVLTAAHCLVG---------- 78

  Fly   165 NFDSP-KFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFN 228
              .:| ..:|.:|.   ||..:..  :..:|...:.|..|:.    ..|.|||.||.|::...|:
Mosquito    79 --HAPGDLMVLVGT---NSLKEGG--ELLKVDKLLYHSRYNL----PRFHNDIGLVRLEQPVRFS 132

  Fly   229 DHVAAV-----CLPPDSGNDVQQVTAAGWGFT-ADGVKSSHLLKVNLQRFSDEVCQKRLRFSIDT 287
            :.|.:|     .:|.::     .|...|||.| |:|...:.|..:|:...|:|.|.|:       
Mosquito   133 ELVQSVEYSEKAVPANA-----TVRLTGWGHTSANGPSPTLLQSLNVVTLSNEDCNKK------- 185

  Fly   288 RTQFCAGSMSSQAD-------------TCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGL 339
                  |......|             .||||||||:..:..|       :|:|::|:.| :.|.
Mosquito   186 ------GGDPGYTDVGHLCTLTKTGEGACNGDSGGPLVYEGKL-------VGVVNFGVPC-ALGY 236

  Fly   340 PSVYTKVHLYTDWIESIVWGN 360
            |..:.:|..|.||:.:.:..|
Mosquito   237 PDGFARVSYYHDWVRTTMANN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/275 (26%)
Tryp_SPc 102..353 CDD:214473 71/272 (26%)
CTR1_ANOGAXP_309033.2 Tryp_SPc 32..250 CDD:214473 71/272 (26%)
Tryp_SPc 33..253 CDD:238113 72/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.