DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CTR2_ANOGA

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_309032.2 Gene:CTR2_ANOGA / 1270347 VectorBaseID:AGAP006711 Length:258 Species:Anopheles gambiae


Alignment Length:274 Identity:71/274 - (25%)
Similarity:126/274 - (45%) Gaps:64/274 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPFMALIGTHRPNKSKSDINW--DCGGSVVHPKFVLTAAHCLETDESKAERLDP 164
            :|||..|.....|:.  :....|       .|  :||||:::.::||||||||           .
Mosquito    33 VVGGEVAKNGSAPYQ--VSLQVP-------GWGHNCGGSLLNNRWVLTAAHCL-----------V 77

  Fly   165 NFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFND 229
            .::....:|.:|.   ||..:..  :..:|...:.|..|:...    |.|||.|:.|::..:|::
Mosquito    78 GYEPSDLMVLVGT---NSLKEGG--ELLKVDKLLYHSRYNRPQ----FHNDIGLMRLEQPVQFSE 133

  Fly   230 HVAAV-----CLPPDSGNDVQQVTAAGWGFTA-DGVKSSHLLKVNLQRFSDEVCQKRL--RFSID 286
            .|.:|     .:|.::     .|...|||.|: :|...:.|..:|:...|:|.|:.::  ..::|
Mosquito   134 LVQSVEYLEKAVPVNA-----TVRLTGWGRTSTNGNVPTLLQSLNVVTLSNEDCKAKMGNPKNVD 193

  Fly   287 -----TRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYTKV 346
                 |.|:...|:       ||||||||:..:..|       :|:|::|:.|| :|.|..:.:|
Mosquito   194 LGHVCTLTKAGEGA-------CNGDSGGPLVYEGKL-------VGVVNFGVPCG-RGFPDGFARV 243

  Fly   347 HLYTDWIESIVWGN 360
            ..|.:|:.:.:..|
Mosquito   244 SYYHEWVRTTMANN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 70/268 (26%)
Tryp_SPc 102..353 CDD:214473 69/265 (26%)
CTR2_ANOGAXP_309032.2 Tryp_SPc 32..250 CDD:214473 69/265 (26%)
Tryp_SPc 33..253 CDD:238113 70/268 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.