DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP007043

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_001237132.2 Gene:AgaP_AGAP007043 / 1270058 VectorBaseID:AGAP007043 Length:575 Species:Anopheles gambiae


Alignment Length:304 Identity:82/304 - (26%)
Similarity:132/304 - (43%) Gaps:62/304 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 RPFEKQCKQYNEVRSAC---QSTP--FIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGSV 139
            :|||       ...|.|   :.:|  .:..|..|...::|:...:..|..::..:   :.||||:
Mosquito    27 QPFE-------VAASTCGVRRLSPMGLVTKGIIAEPGDWPWHVALFAHMKSEKPA---YKCGGSI 81

  Fly   140 VHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYD 204
            :...|||:||||::         :||.|  .:.::.|....|:..|.::|. :.:...::||.||
Mosquito    82 ISQHFVLSAAHCIK---------EPNPD--HYFLKAGIHHLNNDNDTSVVV-YNLFEIILHPKYD 134

  Fly   205 TEDEEQGFKNDIALVELDRKAEF-NDHVAAVCLPPDSGNDVQQV-----TAAGWGFTADGVKSSH 263
                ...|.|||||:..||...| :..:..:||.|.....:..|     .|.|:||     ..:|
Mosquito   135 ----RHTFYNDIALMRPDRAISFASFSIFPICLWPTHNATLIDVLSRSGIAVGFGF-----DETH 190

  Fly   264 LLKVNLQRFSDEVCQKR---------LRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYP 319
            .:...||:.|.:|.:|:         :||......:.||....|.|:.|:|||||.::.......
Mosquito   191 RISETLQQASMKVIEKQQCIEQLPEHVRFLPQDAGKMCAIGTESGANVCSGDSGGGLYFAKDQVW 255

  Fly   320 CLKQVIGIVS--------YGLVCGSQGLPSVYTKVHLYTDWIES 355
            .|:   ||||        .|....:..||:.||.|..||.||.:
Mosquito   256 YLR---GIVSAAARRDLDTGEATCNAALPATYTDVAQYTTWINA 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 76/277 (27%)
Tryp_SPc 102..353 CDD:214473 74/273 (27%)
AgaP_AGAP007043XP_001237132.2 Tryp_SPc 50..297 CDD:238113 76/274 (28%)
Tryp_SPc 50..294 CDD:214473 74/270 (27%)
Tryp_SPc 330..573 CDD:304450
Tryp_SPc 330..570 CDD:214473
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.