DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP007142

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_308619.3 Gene:AgaP_AGAP007142 / 1269964 VectorBaseID:AGAP007142 Length:251 Species:Anopheles gambiae


Alignment Length:276 Identity:81/276 - (29%)
Similarity:123/276 - (44%) Gaps:70/276 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 IVGGTKASGKEFPF-MALIG--THRPNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLD 163
            |||||:|:....|: ::|.|  :|.           |||:::..::|||||||         .:.
Mosquito    28 IVGGTEAAPGTAPYQVSLQGLFSHM-----------CGGTIIDRQWVLTAAHC---------AIL 72

  Fly   164 PNFDSPKFV-VRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEF 227
            |    ||.: |..|..|..|..     :.:.|..:.||..::    :..|.||||||:|....||
Mosquito    73 P----PKLMQVLAGTNDLRSGG-----KRYGVEQFFVHSRFN----KPPFHNDIALVKLKTPLEF 124

  Fly   228 NDHVAAV-----CLPPDSGNDVQQVTAAGWG-FTADGVKSSHLLKVNLQRFSDEVCQKRLRFS-- 284
            .:.|.||     .||.::     .|.|.||| .:..|.....|..:||:....|.|::.|..:  
Mosquito   125 GEFVQAVEYSERQLPVNA-----TVRATGWGKVSTSGSVPRMLQTINLRYVPYEECKRLLEDNPA 184

  Fly   285 -----IDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLKQVIGIVSYGLVCGSQGLPSVYT 344
                 |.|.|:...|       .||||||||:..:       .:|:|:.::.:.| :||.|..:.
Mosquito   185 VDLGHICTLTKEGEG-------VCNGDSGGPLVYE-------GKVVGVANFAVPC-AQGYPDGFA 234

  Fly   345 KVHLYTDWIESIVWGN 360
            .|..|.|||.:.:..|
Mosquito   235 SVSYYHDWIRTTLANN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 80/270 (30%)
Tryp_SPc 102..353 CDD:214473 78/267 (29%)
AgaP_AGAP007142XP_308619.3 Tryp_SPc 27..243 CDD:214473 78/267 (29%)
Tryp_SPc 28..246 CDD:238113 80/270 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.