DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and AgaP_AGAP007252

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_308550.4 Gene:AgaP_AGAP007252 / 1269896 VectorBaseID:AGAP007252 Length:305 Species:Anopheles gambiae


Alignment Length:311 Identity:81/311 - (26%)
Similarity:128/311 - (41%) Gaps:61/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LDHQNLKPAEQTRPFEKQ-----CKQY-NEVR---SACQSTPFIVGGTKASGKEFPFMALIGTHR 123
            :|...::|..:...:.::     .||| .|||   :..:....||.|..|...:||:...|.:..
Mosquito    21 IDWSKVRPMTRMPQYWRRLPKDLLKQYLTEVRNMPAGARDNARIVNGYVAQPGQFPYQVAILSTF 85

  Fly   124 PNKSKSDINWDCGGSVVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELD--YNSTTDD 186
            |..|..     |||||:...:|||||||::.....             :|..|..|  .|..:..
Mosquito    86 PTGSGL-----CGGSVLTANYVLTAAHCVDVSNGG-------------LVIYGAQDRTVNEPSQQ 132

  Fly   187 ALVQDFRVVNYVVHPGYDTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLP--PDSGNDVQQV-- 247
            .:.  |......:||.::    ....:.|||.:.:.....|:|.:..|.||  .|.|||...:  
Mosquito   133 RIA--FEQSGVRLHPNWN----PALIRYDIATIRVVSPVTFSDRIQPVTLPRLSDVGNDFAGLIG 191

  Fly   248 TAAGWGFTADGVK--SSHLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGP 310
            |.:|:|..:|.::  |:.|..||....::..|.  :||....:.:....|..|....|.||||||
Mosquito   192 TVSGFGRFSDSIQEASAILRYVNNPIQTNLACS--VRFPGVVQPENICLSGDSGRGACQGDSGGP 254

  Fly   311 I-------FVQHPLYPCLKQVIGIVSYGLVCGSQ-GLPSVYTKVHLYTDWI 353
            :       .||          :|:||:||..|.: ..|||:.:...:..||
Mosquito   255 LTIVRDGTTVQ----------LGVVSFGLALGCELNWPSVFARTTSFLAWI 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 73/268 (27%)
Tryp_SPc 102..353 CDD:214473 71/266 (27%)
AgaP_AGAP007252XP_308550.4 Tryp_SPc 63..295 CDD:214473 71/267 (27%)
Tryp_SPc 64..295 CDD:238113 71/266 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.