DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and CLIPA3

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:XP_024667072.1 Gene:CLIPA3 / 1268922 VectorBaseID:AGAP012591 Length:422 Species:Anopheles gambiae


Alignment Length:290 Identity:87/290 - (30%)
Similarity:130/290 - (44%) Gaps:52/290 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 QC-KQYNEVRSACQSTPFIVGGTKASGKEFPF-MALIGTHRPNKSKSDINWDCGGSVVHPKFVLT 147
            || .||..:    .::|.:.....|.| |:|: :.|:|       ..|: :...|:::....|||
Mosquito   165 QCGMQYPPI----ANSPAVTANQAAYG-EYPWQVVLLG-------PGDV-YVGSGALIDNLHVLT 216

  Fly   148 AAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGYDTEDEEQGF 212
            |||.:....|....|.         |||||.|..|||:...||:|.|..|.|||.:...:    .
Mosquito   217 AAHKISDYTSGTRALK---------VRLGEWDAASTTEPLPVQEFTVARYFVHPSFTAAN----L 268

  Fly   213 KNDIALVELDRKAEF--NDHVAAVCLPPDS--GNDVQQVTAAGWGFT--ADGVKSSHLLKVNLQR 271
            :||||::.|......  ...:|..|||..|  |:   :...:|||..  ..|...|...:|::..
Mosquito   269 RNDIAILRLSGTVALGTTPTIATACLPVTSFVGS---RCWVSGWGKNDFVSGAFQSIPKEVDVPI 330

  Fly   272 FSDEVCQKRLR-------FSIDTRTQFCAGSMSSQADTCNGDSGGPIF--VQHPLYPCLKQVIGI 327
            .:...||..||       |.:||.:..|||....: |.|.||.|.|:.  :.:..|     |:|:
Mosquito   331 VNSANCQTALRTTRLGGNFVLDTTSFLCAGGELGK-DACTGDGGSPLVCALNNRWY-----VVGL 389

  Fly   328 VSYGLVCGSQGLPSVYTKVHLYTDWIESIV 357
            |::|:.||:.|:|.||..|..|..||.|.:
Mosquito   390 VAWGIGCGANGIPGVYVNVASYITWITSTI 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 81/269 (30%)
Tryp_SPc 102..353 CDD:214473 79/266 (30%)
CLIPA3XP_024667072.1 Tryp_SPc 182..418 CDD:238113 81/266 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.