DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3700 and Ctrl

DIOPT Version :9

Sequence 1:NP_611736.1 Gene:CG3700 / 37640 FlyBaseID:FBgn0034796 Length:360 Species:Drosophila melanogaster
Sequence 2:NP_446461.1 Gene:Ctrl / 117184 RGDID:621501 Length:264 Species:Rattus norvegicus


Alignment Length:360 Identity:89/360 - (24%)
Similarity:137/360 - (38%) Gaps:110/360 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ILLLIASVSVVTEYCDNGTGECKELTPSDCPVIFYNQHLIGAEVKYCDEFNDIVCCPIPLDHQNL 73
            :|||..::|:|......|.|     .|:..|.:.|||.::..|                    |.
  Rat     1 MLLLSLTLSLVLLGSSWGCG-----VPAITPALSYNQRIVNGE--------------------NA 40

  Fly    74 KPAEQTRPFEKQCKQYNEVRSACQSTPFIVGGTKASGKEFPFMALIGTHRPNKSKSDINWDCGGS 138
            .|.                     |.|:.|.....:|..|                     ||||
  Rat    41 VPG---------------------SWPWQVSLQDNTGFHF---------------------CGGS 63

  Fly   139 VVHPKFVLTAAHCLETDESKAERLDPNFDSPKFVVRLGELDYNSTTDDALVQDFRVVNYVVHPGY 203
            ::.|.:|:|||||         ::.|.    :..|.|||.|.:|..:.  :|...:...:.||.:
  Rat    64 LIAPNWVVTAAHC---------KVTPG----RHFVILGEYDRSSNAEP--IQVLSISKAITHPSW 113

  Fly   204 DTEDEEQGFKNDIALVELDRKAEFNDHVAAVCLPPDSGNDVQQV----TAAGWGFTA--DGVKSS 262
            :...    ..||:.|::|...|.:...|:.|||.  |.|:....    ...|||..:  ..|..:
  Rat   114 NPNT----MNNDLTLLKLASPARYTAQVSPVCLA--SSNEALPAGLTCVTTGWGRISGVGNVTPA 172

  Fly   263 HLLKVNLQRFSDEVCQKRLRFSIDTRTQFCAGSMSSQADTCNGDSGGPIFVQHPLYPCLK----Q 323
            .|.:|.|...:...|::.....| |.:..|||  .:.|.:|.||||||:.       |.|    .
  Rat   173 RLQQVVLPLVTVNQCRQYWGSRI-TDSMICAG--GAGASSCQGDSGGPLV-------CQKGNTWV 227

  Fly   324 VIGIVSYGLV-CGSQGLPSVYTKVHLYTDWIESIV 357
            :|||||:|.. |..|. |::||:|..:..||..::
  Rat   228 LIGIVSWGTENCNVQA-PAMYTRVSKFNTWINQVI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3700NP_611736.1 Tryp_SPc 102..356 CDD:238113 72/264 (27%)
Tryp_SPc 102..353 CDD:214473 70/261 (27%)
CtrlNP_446461.1 Tryp_SPc 33..257 CDD:214473 75/317 (24%)
Tryp_SPc 34..260 CDD:238113 77/319 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.